KEGG   Paenibacillus sp. JDR-2: Pjdr2_5965Help
Entry
Pjdr2_5965        CDS       T00977                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pjdr2_5965
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pjdr2_5965
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pjdr2_5965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6837896..6838378)
Genome map
AA seq 160 aa AA seqDB search
MSLYNIEVNTIKGEKQTLAPYEGQVLLIVNTATKCGFAPQFKGLQKLHDTYKEKGFAVLG
FPSSQFMNQELENNAEIAQSCELNFGVNFPLYARIDVNGDTAHPLFQKLKKDARGILGSK
RIKWNFTKFLVNKEGKVVKRFGPNVTPERIDSEIQALLSK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtccttatacaatattgaagtcaacacgattaaaggcgagaaacaaacgctagctccg
tacgaaggccaagtgctgctaatcgtaaatacggcgaccaagtgcggatttgctccgcag
ttcaaaggactgcagaagcttcatgacacgtacaaagagaagggctttgcggtattaggc
ttcccgagcagccagtttatgaatcaagagctcgagaataacgcggagatcgcgcagtcc
tgcgagctgaactttggcgtgaatttcccgctctacgcgagaatcgacgttaacggagac
actgcgcatcccctgttccagaagctgaagaaggatgcacgaggtatccttggttcgaag
cgcattaaatggaactttacgaaattccttgtgaacaaggaaggcaaagtcgtgaagcgg
tttggtccaaacgtgacgccggagcgaattgattccgagatccaagccttgcttagcaag
taa

DBGET integrated database retrieval system