KEGG   Pseudomonas knackmussii: PKB_0298Help
Entry
PKB_0298          CDS       T03081                                 

Gene name
gabt1
Definition
4-aminobutyrate aminotransferase GabT (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pkc  Pseudomonas knackmussii
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PKB_0298 (gabt1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PKB_0298 (gabt1)
   00310 Lysine degradation
    PKB_0298 (gabt1)
Enzymes [BR:pkc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PKB_0298 (gabt1)
    2.6.1.48  5-aminovalerate transaminase
     PKB_0298 (gabt1)
Amino acid related enzymes [BR:pkc01007]
 Aminotransferase (transaminase)
  Class III
   PKB_0298 (gabt1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
325515..326795
Genome map
AA seq 426 aa AA seqDB search
MTKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKLSHTCFQVLAYEPYIELAEEIAKRVPGNFPKKTLLVTSGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALAPCELHGVS
EDESIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKPFMQRLRALCDQHGILLIAD
EVQTGAGRTGTFFATEQLGVVPDLTTFAKSVGGGFPISGVCGKAEIMDAIAPGGLGGTYA
GSPIACAAALAVLKVFEEEKLLERSQAVGETLKAGLREIQAKHKVIGDVRGLGSMVAIEL
FEGGDVHKPAAELVSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIPDAQLQKGLAILAE
CFDELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaccaacgaatccctgctgaaacgccgtcaggccgccgtaccgcgcggtgtt
ggccagatccacccggtcgttgccgagcgcgccgagaactccaccgtgtgggacgtcgaa
ggtcgtgaatacatcgacttcgctggcggcatcgccgtactgaacaccggccacctgcac
ccgaaagtggtcgcggccgttcaggagcaactgaccaagctgtcgcacacctgcttccag
gttctggcgtacgagccctacatcgagctggccgaagagatcgccaagcgcgttccgggc
aacttcccgaagaagaccctgctggtcacctccggctccgaagccgttgaaaacgccgtc
aagatcgctcgcgctgccaccggccgcgctggcgtgatcgccttcaccggcgcctaccac
ggccgtaccatgatgaccctgggcctgaccggcaaggtcgttccgtactccgctggcatg
ggtctgatgccgggcggcatcttccgcgccctggctccgtgcgagctgcacggcgtgagc
gaagacgagtcgatcgccagcatcgagcgcatcttcaagaacgacgcccagccgcaagac
atcgctgccatcatcatcgagccggttcagggcgaaggtggcttctacgtcaactccaag
cccttcatgcagcgtctgcgcgccctgtgcgaccagcacggcatcctgctgatcgctgac
gaagtacagaccggcgctggccgtaccggcaccttcttcgccaccgagcagctgggcgtg
gtaccggacctgaccaccttcgccaagtccgttggcggcggcttcccgatctccggcgtc
tgcggcaaggccgagatcatggacgccatcgctcccggcggcctgggcggcacctacgcc
ggtagcccgatcgcctgcgccgcggccctggccgtgctgaaggtgttcgaggaagagaaa
ctgctggagcgttcgcaagctgtcggcgaaaccctgaaagccggtctgcgcgaaatccag
gccaagcacaaggtgatcggtgacgtacgcggcctgggttcgatggtcgccatcgagctg
ttcgaaggcggcgacgtgcacaagccggctgccgagctggtcagcaagatcgttgtccgt
gctcgcgagaagggcctgatcctgctctcctgcggcacctactacaacgtcattcgcttc
ctgatgccggtaaccatcccggacgctcagctgcagaaaggcctggccatcctggccgag
tgcttcgacgaactggcctga

DBGET integrated database retrieval system