KEGG   Plasmodium knowlesi: PKH_020890Help
Entry
PKH_020890        CDS       T01094                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
pkn  Plasmodium knowlesi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(join(372444..372786,372940..374864))
Genome map
AA seq 755 aa AA seqDB search
MGAMNTVSMSVAPLKGALCRSEEDTDENCITYDDMFRNYDSEDNSEGRDCLDESCNVKDY
ITSLHFNNPLEEKILSKRKGAKSVGGEKKGKVNNDGEEVAKNGDNVEEKENSYIKEGGTI
MGEGNGSTCPHESKEDIFGSKPTRVGIFPMESSTVRQNSSGQNYHMNSKDYKSGGAKDLP
YGKKSSGGGAPGGANSTSMMMPPDPFASENNVMKKFPSLGLPESDDEKGENGEVNFKSGK
ALPLNTENRKKEKKNDSLKNNTTGKGDGSNLNIVGHQTEQIGNHTINGQLNEFPYETPMQ
NTTPGGALNKNICIKKNALNDNYQEVDFTTSSLRTKNRPGEGNKTKKGGVAPKYLMLKVD
TCELKRMTRSKLKHPPVGLVNLGNTCYLNSLLQALYSTVSFVVNLYLFNIRQNVKEGGEE
SSNPFVEKQKHTLGPNGTNTLKGPVHRLSNVDGLNNIMNSIGKMNTLTRLNTLNGIPPMN
HIGTVESERFLQELKNLYIIMTTTNKMYVSPDSILGLLPYELNNRNQQDVTELLRYIFDK
LGGSSREFLRLIFSGVLVQKVQCQKCFFVSKKEEVIHDLSFPIPVRASEKLSIQKYFDSF
VQKEKIHGSNKYRCSKCNKRRNALKWNEIISPPCHLILILNRYNWSFSSNEKKKVKTHVK
INSKIVVNSFDYKLYGAIIHGGSSASSGHYYFIGKKSERDQEDETNDWYQMNDSVITKVS
SKLINKISKDPSNDHTPYVLFYRCKQAPPSPALHF
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgatgaacacagtatcaatgagcgttgccccgttgaagggggctctttgccga
agtgaagaagacacagatgaaaattgcattacctacgatgatatgttcagaaattacgac
agcgaagacaattcggaggggagggattgtctggatgagagttgcaatgtgaaggactac
ataacaagcctgcacttcaacaacccacttgaggagaagatactttccaagaggaaaggc
gccaaatctgtaggtggggagaagaaaggaaaggtaaacaacgatggcgaggaggttgct
aagaacggggacaatgtcgaggagaaagaaaattcttatatcaaggaaggaggtacaatt
atgggagagggaaacggatcgacgtgtccacatgaatcgaaagaggatatattcggatcg
aagcccacacgtgtaggcattttcccgatggagtcttccactgtcaggcaaaattcctcc
ggtcagaactatcacatgaacagtaaagattataaaagtggaggggcaaaggacctgccg
tatgggaagaagagtagcggaggaggagccccagggggggcaaattcaacatcaatgatg
atgccacctgatccattcgcaagtgagaacaacgtgatgaagaaatttccatcactggga
ttacctgagtctgacgatgagaaaggagagaatggcgaagtgaatttcaagtcgggcaag
gcactaccattaaacactgaaaaccgaaagaaggaaaaaaaaaatgattctcttaaaaac
aacactacaggaaaaggggatggaagtaatcttaacatagtcggccatcagacagaacaa
attggaaaccacacgatcaatggacagctgaatgagttcccgtatgagaccccaatgcaa
aataccacccctggtggtgcactcaataaaaatatttgcataaaaaaaaatgcacttaat
gataattatcaggaagtggatttcacgacgagcagtctgagaacaaagaacagacctgga
gaagggaataaaacgaaaaaaggaggagttgctccaaagtatctaatgctaaaggtagac
acttgtgagttgaagagaatgacaaggagtaagctgaagcatccaccggttggtttagta
aatttaggtaacacttgctacctgaatagccttctgcaagccttatacagcaccgtatcc
ttcgtggtgaatttatatctgtttaatattcgacagaatgtgaaggagggaggggaagag
agttcgaatccatttgtagagaagcagaagcatacccttggacccaatggaacgaacaca
ctcaaaggaccagtgcacagacttagcaatgtggacggattaaataatataatgaattct
ataggaaaaatgaatacgcttaccagactgaatacactgaacgggataccccccatgaac
catataggcacggtagagtcggagagattcctacaggagttaaaaaatctctacattata
atgacgaccacgaacaaaatgtatgtttctcctgatagcattttgggtctcctcccatat
gaactgaacaatcgaaaccaacaagacgttacggaactgttgcgatatatttttgataaa
ttgggagggtcgagtagagaattccttcgactaatattctcaggcgtgcttgtgcaaaaa
gtgcagtgtcagaaatgtttctttgtctctaaaaaagaggaagtaattcacgacttgtcc
ttccctattcctgtaagggcatcagagaaactgtccattcagaagtattttgattcgttt
gtgcagaaggagaaaatccatggctccaacaagtatcggtgttccaagtgcaacaagagg
aggaacgcccttaagtggaacgaaataatttctcctccttgccacctcatcttgattcta
aacaggtacaactggtccttcagctccaacgaaaagaagaaagttaagacacacgtgaaa
atcaactcaaaaattgtggtgaacagttttgactataagctgtatggagccattatccac
ggaggctcgtctgcttcatctggccactactatttcattggaaaaaaatcggaacgggat
caggaggacgaaacgaatgactggtatcagatgaacgactcagtaatcaccaaggtgagc
tccaagttgataaacaagatttccaaggacccctccaacgaccacacgccatacgttttg
ttttaccgctgcaagcaggcgcccccctcacctgctctccacttctaa

DBGET integrated database retrieval system