KEGG   Plasmodium knowlesi: PKH_021090Help
Entry
PKH_021090        CDS       T01094                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PKH_021090
Peptidases [BR:pkn01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PKH_021090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(471489..471544,471738..471906,472047..472115,472362..480968))
Genome map
AA seq 2966 aa AA seqDB search
MYNSNDDEEENYSRNRRSNSSDSGNGDENGMLNDPINTYNHYNNFNRFHEQNMQACKIDE
IYVDDSYDENGSYVQKGENLSDKNHFEISKNVNFDGPYSHKNLREVTENEVELVVDNFFD
RIRSNEDVYSEWKVCPNFIFRLLFIAKSRSNNYMYPVASSFIEAIAKDDWVPDWGFSTVQ
YYIILINLADYRKSYYKIDHFSFSHLNTDRGWHNFVPFEKLREPGFINENGQIVLRAGVF
PLGSESFKNSRDINYDSKSRTGFVGLQNHGATCYMNALLQLLYHINIFRKAVCMMIFNIE
NIIGEKTLEFFKKKFEKKKRRKKLCLNGDTAKMTVEGEQVDSKKAMNRKKKKTKFERVES
SDSEQYKGTSPMRMVPYTPSDNNGEEGNPYGDQHKRDGVHHDMRMQGGHFGGSENISNPD
ESELYKMEKHNDKNRVKNDMKNEDLGMRHLRSDDNDNRSNTSGHLRHSKEEPLGAPHNAA
LADGSPFSGSPLMERPYDHLHQLQADKVENVKEKKTISEYQQMYAPHEEVNNNEGEGYRR
SKVVNIGRINSNDISKIPNIPGVGGNEYEIKNNKKHAYVHNSSSDPSIDTGGVQNNISNN
DSGEVYYDNSLYKSEGYNNEMVMTGNCKKNKKKGMVYESKKNLKKKKKIFKYGNERKVEE
AENNDHVMSPFSSSDNMSNISTLSKEKKKKKFASNNNFHLTRSDSVKKENDSSVNNAVGY
SEGEEGPVPRNGESSPSGSLHCSGAKGDGNVYGSAEDNYCTDDQQDETHGALRGEEDGSY
SDSDMSVLSITSSGSSSYVSCSSTSSSYYHKKKRKTKYDKSKEIDYKNILLEEENEKKNI
LPTSLALQNLFYKLHCMNDAVSCKELIRSFGWDASDVFTQQDTHELLKLLLDKVEEQMKG
TVVEGSVKKMFEGEVETYIECLDIDYKSVRKETYEDIQLDVQGCNNIYESLDKAIEAEVL
EGDNIYETDGYGKQKAKKGMRFLSFPNICIFLLKRFTFDLQRMETVKLNNRFEFYKELDL
SKYCKNGGEYVLQAVSVHQGNMNSGHYYSFSYKHNENFWLKCDDDKIFRVSEYSVINDNF
GGYDINMETDLYDFDIADKIKQRMKHYSAYMLVYVKKSLIPKLIKECDPAVVNPQVVKRC
RMEEIINRRRTKLKQEILQYVKIRVFDKYSYLYKSFSDLPPVGIPSLFNIKFDRNKTVLE
TFSKILKIIKKIYLCKRKKRADYLLHQSKKAKMEKVEKPPPSLRDNRPVGDQSRSMLLKS
ESPGEGGDPYRQALLGKHVEGERISKGERDKAGATSSRNDRESSDGNGRSRSEHGISREK
KRHEKKWNECIQEKGARRDGSKKGVSKSGFSAECTTPEEGSLDLNDACDKSSEELPSQSC
PSDGSISTVSSVPSCCSTKSIDKYLKYLSRKKNERSKRRSSNVNKSRMKSFSSSNNSSYY
SSSYLSHSGEEDSYSSASSSSSNGYVKEKKCFYVLLPTNDVYRYFPLDMKVNSQLYLYEL
LKKTNKESNDLFPTIDILYLPYNKKTSIRKSNSSTKNKNVLFFFKYFDIYAEEKIGDTAL
ICLDIMYCDVYLKPKELESVIIQKILKAMKKGYITNYNYELWRNYLNEEEEYYYVDDPLN
FKIFIEYKNKCNLIKSKKIIAHNKMVPGDILIFNFLSNAELEKKKNFILRLGTRKEDLFL
TEENQITYDLFFNADVFSKILYRKKKLIEKMQNCCYIVSNKNGVYYKVPSVGSDSGDCAF
PPVIGTGVSNPHGGSDEHSKKDLLNDEYFLIGSNSNLRKKKTKKETESEVPVQVDANLDF
ATPNRMQQENYFAYAEDQNDGKIFRRSEETEKENSGKIQVASDRTEGTPQLGQSEADREK
DQNDKSLNYYRSLENPVQGVHRSLYTQHTDDGKHAHRADPPLPLNMDEIKDNTQVMDENM
DDVENANFNALNMTKENLNSQEVMNLYLCLKKLSTKFEKNGMNYDYCLLSKNMLMSVKEA
SLNNKKLIFKRKKKHPPNIYNNECVNICRDYQYPFYSPPTSDLSTDDEKRVPQKGSIQKE
EAKKKKKKKNCDEAVMKGSLQKLNCTNGYAENGIANLTINTGKNDEGEANELLYKCTSNS
NTALGERITKGKNTSAISNSDLRNDYRYNSNLRVPSVNFNSSNENNISNDLIARNDSEIS
FCSSANSDLTYTSESTAYYMFNAEESLESVYTNEIYDHKKKRKKKKKKKKKKMATSTEMR
IHNNVDPSAAPINSDQYKGNIFNLNSDDEKIEAYVDMAHSKATTEVDNYANSGGHSGQSG
RSKIKTEESGRKHGGHIKEASNDGSRCSKSQESENSKGIGIPPKVDQLGHNFIKEGDHRR
NNTDKVSHVGESSGEQINRSKSCKKEGKQTPDGTIRMDDEHVSDSIYSYHKNRGDGGAQN
VTCEDTDNDEATEAHMNDRSRALLQENMNSINSMNVMGSNENVSAEAENVIGVSSKVGTP
NLMVSNDPSGNAHSSEPANDSIMSSNVPLGSGRSQANRRRKNRRSRIIKKCGGVKDKEEP
ILPFYVICDYLDFVERKIYVNRFRFKLYDPIYQLGKYRNCAGVVLKRNLKKSCLNYIDSN
FIFLKKELCKIDLDIDIRCPTKQIFKHVCYRMNVDPTHVLIFPYPPLNSPINFNPYNIDS
FTSNSDSDGENYQKNSSSTYGPMPFETLIKQHAIALEHNSLTEQKTFCLSLLPFHYKYFT
RLYPEDSPKYFHYVVHLFNANVQSVAAFTGHIKLKKSLPNKNKEEENSFQGDQDSSSEAS
GSSMSDRSSSTMGNKPYFSNNYTTVQDLIDKIKLEINPYLKKRGIDVKQKFRLLFTFGPK
IKYLNNDEQLIQMDFVKTNHIKNVYVTPLRMEPDFTDEQKHLIETDQLKIIHVFNQTPSK
EVFGYSFDVLVDPNDNMLDIKNRIRKRTLLPKYIFDKITFFEFENGQRIWRSNDDTINWK
NKQFAIIIGEHHAPSQSKPQMGMKIA
NT seq 8901 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacagcaacgacgatgaggaggagaactactcgaggaatagaagaagcaactca
tcagatagtgggaacggagacgaaaatgggatgctaaacgatccgataaatacgtacaac
cattacaataactttaatcggtttcatgaacagaatatgcaggcatgcaaaattgatgaa
atttatgtagacgatagttatgatgaaaatggtagttacgtccagaaaggagagaatcta
tccgacaaaaaccattttgaaataagtaaaaatgtaaattttgatggaccatacagtcat
aaaaatctgagggaggttacagaaaatgaagtcgagttagttgtggacaattttttcgat
cgaattagaagcaatgaagatgtgtactctgaatggaaagtatgtcccaattttattttt
aggcttttatttattgcaaagtccaggtccaataattatatgtacccagtggcatcatct
ttcattgaagccatcgcaaaggatgactgggttcctgattggggattcagtactgttcag
tattatataattttaataaacttagcggattacagaaaatcctattacaaaatagatcac
tttagtttttctcatttgaatactgatcgaggttggcacaattttgtgccctttgaaaaa
ttaagggagccaggatttatcaacgaaaatggacaaattgtgttaagggctggcgttttc
cctctgggttcagaatcttttaaaaatagcagagatataaactatgatagcaaatccagg
acaggatttgttggtctccaaaatcatggagccacttgctatatgaatgctctgcttcaa
ctcctataccatattaacatttttcgtaaagctgtttgtatgatgatttttaacatagag
aatattattggggagaaaaccttagaattttttaagaaaaaatttgaaaaaaaaaaacgg
aggaaaaagttgtgcctcaatggtgacaccgccaagatgactgttgaaggtgaacaggtg
gactccaagaaagccatgaaccgaaagaagaaaaagacaaagtttgaacgtgtagagagt
tccgattcggagcagtacaagggtacttcccccatgaggatggtgccctacacgcctagc
gacaacaatggggaggaaggcaatccttatggggaccaacacaaacgggatggggttcat
cacgatatgcgaatgcaaggtggacattttggaggatcggaaaacatttcaaaccctgat
gaatcagagttgtacaaaatggaaaagcataatgacaagaacagagtaaagaatgacatg
aagaatgaggacctggggatgaggcatctaaggagcgatgacaacgataatagaagcaat
accagtggtcaccttagacattcgaaggaagagcccttgggggcaccgcataatgcagcc
ttagcggatgggtcccccttcagtggatcccctctgatggaacgcccatatgaccacctg
catcagctgcaagcggataaagtagaaaatgtcaaagagaaaaaaactattagcgaatat
cagcagatgtacgccccgcatgaggaggtaaacaacaacgaaggggaagggtatcgacgt
agcaaggttgtaaatattggtcgaatcaacagcaacgacatttccaaaattccaaacatt
cctggcgttgggggcaatgagtacgaaataaagaacaataaaaagcatgcctatgtgcac
aattcgtcgtctgatccctccatagatacaggaggagtgcaaaacaatattagcaacaac
gatagcggtgaggtatactacgataattccttgtataaaagcgaaggatataacaacgaa
atggtgatgacagggaattgtaagaagaacaaaaaaaaaggcatggtctacgaatcaaag
aagaatttaaaaaaaaaaaaaaaaattttcaaatatggaaatgagcgaaaagtggaagag
gctgaaaataacgatcatgtcatgtctccctttagctcctccgataacatgtccaacatt
tcgaccctgtccaaggagaagaagaaaaagaagttcgcttctaacaacaattttcattta
acgagaagtgatagcgtgaagaaagaaaatgacagctcagtgaataatgctgtgggttat
tcggagggggaagaaggccctgtgccgcgtaatggagaatcatcgccctcgggtagtctt
cattgctcgggtgccaaaggtgacggcaacgtgtatggtagcgccgaggataactattgt
acagatgatcagcaagatgagacccatggtgccctgcggggagaggaggatggatcctac
tcagacagcgacatgtcagtcctgtcaatcacctcctccggatcgtcgtcctacgtgtcc
tgctcttcgacctcctcgtcttactaccataaaaaaaagagaaagacaaaatatgataag
tcgaaagaaatagattacaaaaatatcctcctggaggaagaaaatgaaaagaaaaatatc
cttccaacatccttggcgttacaaaatttattttacaaattgcattgcatgaatgatgca
gtgtcgtgtaaagagttgatcagatcctttggatgggacgcaagtgatgtattcacacaa
caggacacacatgagttgctaaagttgttactagacaaggtggaagaacaaatgaaagga
acggtagtcgaaggatcagtgaaaaaaatgtttgaaggagaagtagagacttatatagaa
tgtctagacatagattacaaaagtgtgagaaaagagacatacgaagatattcagctggac
gtacaaggatgtaacaacatttatgaatcccttgataaagcaatcgaggcagaggttcta
gaaggagataatatttacgaaacggatgggtatggaaaacagaaagcaaaaaaagggatg
agatttttgagcttcccaaatatttgtatatttctcctgaaaagattcacattcgatttg
caaagaatggaaacggttaagctgaataatcggttcgaattttacaaagaattagatctg
tctaaatattgtaaaaatggaggggaatatgtcctacaagcggtgtcagtgcaccaagga
aatatgaacagtggacactactattccttcagttataagcataatgaaaatttctggttg
aaatgtgatgatgataaaatatttcgcgtgagtgagtactcagtgattaacgacaacttc
ggtggatacgacatcaacatggagactgacctgtacgattttgacatcgctgataaaatt
aagcagaggatgaaacactatagcgcctatatgctcgtctatgtaaagaaatcactcatc
ccgaaacttattaaggagtgcgaccctgcggtagtgaacccacaggttgttaaaagatgt
aggatggaagaaattatcaacagaaggagaacgaaactgaaacaagaaatattacaatat
gtaaaaattagagtcttcgacaagtactcttatctatacaagtcgttcagtgacctaccg
ccagttggcattccgtctctcttcaacattaaatttgataggaataaaaccgttttggaa
accttctctaaaattctgaaaatcataaagaagatttacctctgcaagaggaagaagcgc
gcggattatctgttgcaccagtcaaagaaggctaaaatggagaaggtggaaaagcccccc
cccagcttgagggacaatcgccccgtgggggaccaatccaggtccatgttactcaaatcg
gaatcccccggagaaggtggagacccataccgtcaagctctcctgggcaagcatgtcgag
ggagagagaatttcaaaaggagaacgtgacaaagcgggagctacatccagccggaacgat
cgcgaaagtagcgatggaaatggacgcagccgatctgaacacggaatatcacgggagaaa
aaaaggcacgaaaagaagtggaacgagtgcattcaggagaagggtgctcgaagggatggg
tcgaaaaagggagtaagcaagagcggttttagcgcagagtgtactaccccagaggaggga
tccctcgacctaaatgacgcgtgtgacaagtcctctgaggagcttccttcgcagagctgt
ccttcggatggttcaatttctaccgtatcttcagttccctcatgctgcagcacaaagtcg
atagataaataccttaaatatttatccaggaagaagaatgaaagatcgaagaggagatcg
tccaacgtgaataaatctagaatgaaaagtttctcttcgtcaaacaattcgtcttattat
tcttcctcctatttgtcccactcaggggaagaggactcttactcctctgcctcttcctcg
tcatcgaatggttatgtaaaggagaagaaatgtttctacgtgttacttcccacgaatgat
gtgtaccgctacttcccccttgatatgaaggtcaacagtcaactgtatctctacgaactt
ctaaaaaaaacgaacaaagaatccaacgatctattcccaaccatagacatattatatttg
ccctataacaaaaaaacatctattcgaaaaagtaattcgagtacaaaaaataagaacgtt
ttatttttttttaaatattttgatatctacgcagaagaaaaaattggtgatacggccctt
atctgtctggacatcatgtactgcgatgtgtacctcaagcccaaggagttagaatcagta
attatccaaaaaatattaaaggcaatgaaaaagggttacattaccaactataattatgag
ctctggaggaattacctgaatgaagaggaagaatactactatgtagacgaccctctgaat
tttaaaattttcattgaatataaaaataagtgtaacttaataaagtcaaaaaaaattatc
gctcataataaaatggttccgggggacatcctaatctttaacttcttgagtaacgcagaa
ttggaaaagaaaaaaaattttatcctccgcttgggcacaaggaaggaggatctttttctc
acagaagagaatcaaatcacctatgatctgttttttaatgcagacgtattcagtaaaatt
ttgtacaggaaaaaaaaactcattgaaaaaatgcagaactgttgttacattgttagtaat
aaaaatggagtttactacaaggtgccttcagtggggtctgattccggtgactgtgccttc
ccacccgtgataggaacaggagtttcgaacccgcatgggggctctgatgaacattccaaa
aaggaccttctcaatgatgaatattttttgattggatccaattccaatctgagaaaaaag
aagacgaaaaaggagacggaatctgaagtgccagtccaggtggatgctaatctcgacttt
gccactccaaaccgtatgcagcaggaaaattacttcgcctacgcagaggatcagaatgat
ggaaagatttttcgacgtagcgaggagacagaaaaggagaactcaggaaagattcaagta
gcatctgacagaacggaaggcaccccccaattgggtcaatctgaggcagatagggagaag
gaccaaaatgacaaaagtttgaattactatcgttcattggagaatcctgtgcagggagta
caccgatccctctatacacagcacacagatgatggaaagcacgcacaccgtgcagatccc
ccccttccgctgaacatggacgaaataaaggacaacacacaggtaatggacgaaaacatg
gatgatgttgaaaacgcaaacttcaatgcactaaatatgacgaaagaaaatctgaacagc
caagaagtgatgaatctgtacctctgtctgaaaaagttaagtaccaaatttgaaaagaac
ggaatgaactatgactactgcttgttaagtaaaaacatgttgatgtccgtgaaggaagct
tctcttaacaacaaaaaactaatttttaaaaggaagaagaaacacccacctaatatttat
aacaatgagtgtgtaaatatttgtagggattatcagtacccattctactctcctcccact
tcggatctctccacggatgatgaaaaaagagtgcctcagaaaggtagtatacaaaaggaa
gaagccaaaaagaagaagaaaaaaaaaaactgcgacgaagcagtgatgaagggttcctta
caaaaattaaattgcaccaatggatatgctgaaaacggaatagccaacttgacgattaac
acaggtaaaaacgatgagggtgaagcaaacgaattgctgtataaatgcacctccaatagt
aacaccgcgttaggggaaagaataacaaaggggaaaaacacctcagcaatcagcaacagt
gatcttaggaacgattatcgatataatagcaatttgcgagtacccagcgtcaactttaat
tcttccaacgagaataacatttcaaacgatttaatcgccaggaacgattccgaaatatcg
ttttgctcctcggctaactccgatctgacgtacacatcggagagcacggcctactacatg
ttcaacgcggaggagtcattagaatctgtgtacacaaacgaaatatatgatcataagaag
aaacgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaatggctacctcaaccgaaatgagg
atacataataatgtggatccttcggccgctcccataaacagtgatcaatataaaggaaat
atttttaacttaaattcggatgatgaaaagattgaagcgtatgttgatatggctcattcc
aaggcaacaacagaagtagacaattatgcgaattctggtggccactcaggccagagcgga
agatccaagatcaaaacggaagaatctggtcgcaaacacgggggccatattaaggaggca
agcaatgacggtagtcgttgtagtaagagccaggagagtgaaaattctaaaggcatagga
ataccccccaaggtagatcagttaggtcataacttcataaaagagggggaccaccgaagg
aataacacagacaaggtatcacacgtaggagagtcaagcggtgaacaaattaacagaagc
aagagctgcaaaaaggagggaaaacaaacacctgatggtacgatacgcatggacgatgaa
cacgtgagcgatagcatttattcttatcataagaacagaggggatggtggtgcacagaat
gtaacttgcgaggacactgacaatgatgaggctaccgaggcgcacatgaacgacaggagc
agggccctgctacaggaaaatatgaacagcataaacagtatgaatgtgatgggatctaac
gagaacgtgagtgcggaagcagaaaacgtaattggggtgtcatcaaaggtggggaccccc
aatctgatggtttcaaacgatccatccggcaacgcccacagcagtgaacccgccaatgac
agcatcatgagcagtaatgttcccctgggaagcgggagaagccaagcgaacaggaggaga
aaaaacaggagaagcagaattatcaaaaagtgtggtggagtgaaagacaaggaagaaccc
attctgcccttttatgtcatatgcgactatctagattttgtggagagaaaaatatatgta
aacagattcagatttaaattatatgatcccatttatcagcttgggaaatataggaattgt
gcaggagttgttttaaaaaggaatttaaaaaaaagttgtttgaattatattgattctaat
tttatatttttaaaaaaggaattatgtaaaatcgatttggatattgacataagatgtccc
acgaaacagatctttaaacatgtctgctaccgaatgaatgtggaccctacacatgtgctg
atttttccgtacccgccgttaaatagccctataaattttaacccttacaatattgattcc
tttacctctaattccgattcggatggtgaaaattaccaaaaaaatagtagctccacgtat
ggacccatgccatttgaaacgctaataaaacaacatgccatagcattagagcataactca
ctcaccgaacagaaaaccttttgtttgtctcttcttccatttcattacaaatacttcacg
agactctacccggaagattcccccaaatatttccattatgtagttcacttgttcaacgcg
aatgtacagtccgttgcggcatttacaggccatattaagcttaagaaaagcctacctaat
aaaaataaagaggaagaaaattccttccaaggggatcaagactctagcagtgaggcttca
ggatcgtccatgtcagacaggtccagtagcaccatgggaaacaaaccctatttctccaac
aattacacaacggtgcaagatttaatcgacaaaattaaattagaaattaatccctacctg
aaaaaaagaggaatagacgtgaagcaaaaatttagattgctctttaccttcggccccaag
attaaatatctgaacaatgatgaacagctcatacaaatggattttgtcaaaacgaaccat
atcaaaaatgtctatgtcactccgctcaggatggagcctgattttaccgacgagcagaag
catttgatagaaacggatcagctgaagataattcacgttttcaaccagacaccttcgaag
gaagttttcggctacagttttgacgttctcgttgatccaaatgataacatgctggatatc
aagaacaggataaggaaaaggaccctcctgcccaagtacatattcgacaaaatcacattc
ttcgagtttgaaaacggacagaggatttggaggtccaatgacgacacgataaattggaag
aacaagcagttcgccatcattataggagaacaccatgccccatcccagtcgaagcctcaa
atgggaatgaaaatagcataa

DBGET integrated database retrieval system