KEGG   Plasmodium knowlesi: PKH_031160Help
Entry
PKH_031160        CDS       T01094                                 

Definition
ubiquitin specific protease
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PKH_031160
Peptidases [BR:pkn01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PKH_031160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3:51574..52725
Genome map
AA seq 383 aa AA seqDB search
MNLAEHKLRDLFYAKNYKYYAKYDNCGNFQRRHTSFQNNGNVCYCNASLQLLLSIKPLCI
YLLSKFEKIYGRTKSKSKYKGDILKALFYIIEETYKVEKGYLCTDKHINLLKKMKKYNSN
IVINAQNDAHEFLLMLLNYINVECNRDSNFPPNFEIILDDKDKKEKASEKYWAKYLFKDN
SIITDLLGFQNISSITCTHCGHTRYSFEFCLDLGLEFQSEHVQSTSLIDLLRSNIMKSDD
FCHLFCPICKSKQNSSIKKGLYRMPNLYMIIYIKRFKWSYECTNYFKSRVKKIDTTVLLP
WDGLIDFTSFAYMSNHESLSNSKYLIESFICHSGNSYNGHYTAVVKHTDGFYKCNDEKMK
KLTNPFNPENISDIYLLLLRRVT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagctgaacacaaactgcgtgatttattctacgcgaagaattacaaatattac
gccaagtatgataactgcggaaatttccaaaggagacacacgtccttccagaacaatgga
aatgtgtgctactgcaacgcctccctccaactgttactctccatcaaaccgctctgcata
tacctgctaagcaagtttgaaaaaatatacggaagaacgaaatcaaaatcaaaatataag
ggagatatactcaaggcactcttttacattattgaggaaacgtacaaagttgaaaaaggg
tatttatgcacagacaaacatattaatcttttaaaaaaaatgaaaaaatataattccaac
atagtgatcaatgcacaaaatgacgcacacgaattcttgttaatgctactcaactatata
aacgttgagtgcaaccgagattctaatttcccaccaaattttgaaatcattctcgacgat
aaagataagaaagaaaaggcatcagaaaaatactgggcaaaatatttatttaaggataac
agcataataacagatcttttggggttccaaaatatctctagcataacctgcacacattgt
ggacatacaagatacagttttgaattttgcctagacttagggttagagttccaaagcgaa
catgtacaaagtacatcactaattgatttattaaggagtaatatcatgaagagcgatgat
ttttgccacttattttgccctatctgtaaatccaaacaaaatagttccattaaaaaaggc
ctctacagaatgcccaatttgtatatgattatttatatcaaacgatttaagtggagttat
gagtgcaccaattatttcaaaagtagagtgaaaaaaattgacacaacagttttacttcca
tgggatggattaattgattttacttcctttgcttacatgtccaatcatgagtctttatca
aactcaaaatatctcatcgagagctttatttgccacagcggtaatagttacaatggtcac
tacacagccgtcgttaagcataccgatgggttctacaaatgcaatgatgaaaaaatgaaa
aaactcactaacccctttaatcctgaaaatattagcgacatttatctgctcctacttaga
agggttacctaa

DBGET integrated database retrieval system