KEGG   Plasmodium knowlesi: PKH_050300Help
Entry
PKH_050300        CDS       T01094                                 

Definition
disulfide isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PKH_050300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
5:join(177592..177764,177988..179263)
Genome map
AA seq 482 aa AA seqDB search
MRTKLLSLFLFLIPLVLRNYARAHEDLFNEHITTIHDGELNNFITKNDVVLVMFFAPWCG
HCKRLIPEYNEAANMLAEKKSEIKLASVDATTENALAQEYGITGYPTMIMFNKKNRVNYG
GGRTAQSIVDWLQQMTGPVFTEITTNIEEVLKEKNIAVAFYLEYTSEDNELYKNFNEVGD
KNREIAKFFVKKNDKHNKISCYRKDEKKVDYDEKVSLSEFVSTESFPLFGEINTENYRFY
AESPKELVWVCATTEQYNEIKEEVRLAASELRAKTHFVLLNIPEYADHARASLGLNEFPG
LAYQSSEGRYLLPNAKESLHNHKAIVTFFKEVEEGKVEKSLKSEPIPEEDKNAPVKVVVG
NSFIDVVLKSGKDVLIEIYAPWCGHCKKLEPVYEDLGRKLKKYDSIIVAKMDGTLNETPI
KDFEWSGFPTIFFVKAGSKVPLPYEGERSLKGFVDFLNKHATNTPISLDGVPGMEDGTAE
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccaagttgttatccctcttcctttttttaatcccccttgtccttcgcaactat
gcacgagcgcatgaagatctgttcaatgaacacatcaccactatacacgatggagaactg
aacaactttattacgaagaatgacgtggtgttggtcatgtttttcgctccatggtgcggg
cactgcaaaagactcatcccggagtacaacgaagcagccaacatgctagcggagaaaaag
agcgaaataaagctagccagtgtagatgccaccacggaaaacgccctagcacaggaatat
ggaatcacagggtacccaaccatgatcatgtttaacaagaagaatcgtgtgaactacgga
ggaggaagaacagcccaatcaatcgtagactggttgcagcaaatgaccggtccagtgttc
accgaaattaccacaaatattgaggaggtgttgaaggaaaaaaatatagcagtcgcattt
tacttggaatatacatccgaagataatgagctatataaaaatttcaacgaagttggagat
aaaaatagagaaatcgccaaattttttgtaaaaaaaaatgataagcataataagatttca
tgctacagaaaggatgagaaaaaggtcgattacgatgagaaggtatctctgagcgagttc
gtatccaccgaatcctttccactctttggtgaaataaacaccgaaaattaccgtttctat
gcagagagccctaaagaattggtatgggtctgtgccacaacagaacagtacaatgaaatc
aaagaggaagtcagactagccgcatctgaattgagagcaaaaactcattttgttctttta
aacattcccgaatatgctgatcatgcgagggcttccttaggattgaatgaatttccagga
ttagcttaccaatcaagtgaaggaagatacttactacccaatgcgaaagaatcattacat
aaccacaaagccattgtaactttctttaaagaagtagaagaaggcaaagttgaaaagtca
ctgaaatcagaacctattccagaggaagataaaaatgctcctgttaaagttgttgtcgga
aactccttcattgatgtcgtacttaaaagtggaaaggatgtgctcatcgaaatttacgct
ccatggtgtggtcattgcaaaaagttagaacctgtatatgaagatctaggtagaaaatta
aaaaaatatgattccataattgttgccaaaatggacggtacacttaacgaaacaccaata
aaagattttgagtggtcaggattcccaaccatctttttcgtcaaggctggttcaaaagtt
cctctgccatacgaaggcgagagatcattaaagggcttcgtcgatttcctgaacaagcat
gccactaatactcccatctcactcgacggtgttccaggcatggaggatggcactgcggag
gaattataa

DBGET integrated database retrieval system