KEGG   Plasmodium knowlesi: PKH_050770Help
Entry
PKH_050770        CDS       T01094                                 

Definition
histone acetyltransferase gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PKH_050770
Transcription machinery [BR:pkn03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PKH_050770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
5:complement(join(376176..376337,376618..377132,377312..377726,377875..381441))
Genome map
AA seq 1552 aa AA seqDB search
MDYLISREEKEPLWNDLNCHVLIKKKNNEYPFHCWNGSKDEDVDLLNFLKYKNDGFFFYS
EEDKCVAEVPPKGATVLPEYGTTIGKEGVGGVAGFQGTTKRKRMHFESDGRVANLLESYT
SDGLTHKNRLEDPPRGGATKSVNSSAPLKISPDNPENGEANVKENGEANGGADVKENVKE
NVKENEQKDASKKLKIDNLDNLEKFHLSGYATSACEDLDPREGNDLARSSREEEGGKVAT
IDSTTLSLLQMEKDEEGENRHDDPSVSVTECLAFVWEDKMVKMPKSWQARSCATEGNDCS
GGGGGAGNSSNSCSNGGGNGGGNGGGNGGGSAGSGGNHGSSGDDGKGNENRGNGHLDGGH
QVDNQEDEENEEKRNEQKKRKLGEESMHGSFTNGGNALHMGVGDTKMNYLPNGNGMLNGG
IGIIPPHSSTHNELIDQDRAISSAQRKMSVGGNYSNSSSSMSKVESGPLIFSSGNKIPLQ
SMSGASGNVSHMNGVKHNPEGGNARNGTILGANKIVGMNSFNGNMSFSKNKLFMGNPQMS
FVSNANVGGVKGSRINNMGDLGRMGDVSRMGELSRMGEAGRMNGPHFKDMNDEYCPESKK
RDTGKKEIMEGPLKSNDMNNYPNSAIGMVNNNMNMLPPHGMNSTNAFLNNSMGRMNSLNG
MKGIGNQYNAMNVSPMMGPGGNNSYNFHVPAAHPYGGMNLSNSIGMMGGGVGNAPGMGGG
ILPASPMGDMHGGMMGGLMSGPHGSIPLVSSSSRAGSATQVAGPKGNKNVSSKNVNNKCV
NNKSVNNKSVNNKSVNNKNVEGNTAETESEKKKKDTQSKNKNTNKMSTNTESSKNVIKNI
RMEDLTFSENIYLKNVDGLDLSKNFINGKYCSKLPPNEKIYNIVNYIVKNSLVDYLLDFY
NNDNLFYNEKIDLSDGNSGVDSGPRTGEQETEKEKNGENKKDEVCKAEETLNHDNAKQEV
KHEDDEFKKEKVVDSVTPTGEATSENPGGEARKETDDVLIPDEELKGESTPSMTNKKNAP
SENSSVNNRNEKKFDAVEMKESATINSNSGNGEKNVNDEGDESNKYILIEITKSICSIIN
LQQLMPVNTRLNNPNLIYDSNYETIYSKWKSFLRKEQSSGNVISMCFSRDFLHSVLLCNY
VTIIEDLKKTAVKKKIKFFFLNLCLEAGLSVNIALMLFINAAKQSNKLQSLLPSETGLGY
LHRDAGGAKEENMGIITFECITNDREPDHLIKLITLKNIFSRQLPKMPREYIVRLVFDRN
HYTFCLLKKNTVIGGVCFRPYFEQRFAEIAFLAVTSTEQVKGYGTRLMNHLKEHVKKFGI
EYFLTYADNFAIGYFRKQGFSQKISMPKERWFGYIKDYDGGTLMECYIFPNINYLRLSEM
LYEQKKTVKKAIHFIKPQIIFKGLNFFSQNKGVNSAIHPSNIPGLLEVGWKKEAKYFPKK
AQNKEVQLKDQILSVLDFLEKQQSAWPFLKPVSLSEAPDYYDIIKEPTDILTMRRKARHG
EYKTKEDFGIELKRMFDNCRLYNAPTTIYFKYANELQALIWPKYECISDGGK
NT seq 4659 nt NT seq  +upstreamnt  +downstreamnt
atggattatctcatcagcagggaggagaaggaaccactttggaatgaccttaattgtcat
gttttgataaaaaaaaaaaataatgaatatcctttccattgttggaatggcagcaaggac
gaagatgttgatcttttgaattttttaaaatacaaaaacgatggattttttttttattcg
gaggaggataagtgcgtagctgaggtaccccccaagggtgcaacggtattaccagaatat
ggaaccacaataggaaaagagggagtaggaggtgtagctggtttccagggtacaaccaaa
aggaaacgaatgcacttcgagtccgatggacgggttgccaacctcctggagagttacacc
tctgacggattgacacacaagaaccgtttggaagacccgccacggggaggtgccacgaag
agtgtgaacagtagcgcccccttgaaaatatccccggataatcctgaaaatggggaagca
aatgtgaaagaaaatggggaagcaaatgggggagcagatgtgaaagaaaatgtgaaagaa
aatgtgaaagaaaatgagcaaaaagatgcctcgaagaagctgaaaattgacaatttggat
aatctggagaaattccatttgagtggatatgcgacatcggcgtgtgaggatctagaccca
cgggaagggaatgatttggctcgttcttcgagggaggaagaaggaggaaaggttgcaacg
attgacagtacaacgttgtcattattgcagatggaaaaagacgaagagggggagaaccgt
catgatgatccctcagttagcgttaccgagtgccttgccttcgtgtgggaagacaaaatg
gtgaaaatgccgaaaagttggcaggccagaagttgcgcgacggaaggaaatgactgcagt
gggggaggaggtggagctgggaactcgtccaacagttgtagcaacggtggtggaaatggt
ggcggcaatggtggcggcaacggagggggaagcgcgggaagtggaggaaaccatgggagc
agtggagacgatgggaagggaaatgagaatcgtggaaatggacacttggatggtggccac
caagtagataaccaggaggatgaggagaacgaggagaaaaggaacgaacagaaaaaacgc
aaactgggcgaggagagcatgcatggtagttttacaaacggtgggaatgctctacacatg
ggcgttggggacaccaaaatgaattacttgcccaacggaaatggaatgcttaatggaggg
ataggcatcatcccccctcactccagtacacacaatgaactgattgatcaggacagagca
atatctagtgctcaaaggaaaatgtcagtaggcggtaattacagtaacagtagtagtagt
atgagcaaagtggaaagtggtcccctcattttttcctctggcaacaagataccgttacag
agtatgagtggcgcgagcgggaatgtatctcacatgaatggagtgaaacataatcctgaa
ggtggaaatgccagaaacggaaccattttgggggcgaataaaattgtcggcatgaacagt
tttaacggtaacatgagcttctcgaagaataagctttttatgggaaacccgcaaatgagc
tttgtgagcaatgcaaatgtgggtggtgtcaagggatcgcgaattaacaacatgggtgat
ctgggccgcatgggtgatgtgagtcgcatgggtgaactgagtcgcatgggtgaagcgggc
cgaatgaatggccctcacttcaaagacatgaacgatgagtattgcccggagagcaaaaaa
agggatacaggaaaaaaagaaattatggaaggaccattaaaaagcaacgacatgaacaac
taccctaacagtgccatcggcatggtaaacaacaacatgaacatgttgccccctcatgga
atgaatagcacgaacgcatttttaaacaatagcatgggtcgaatgaacagtctgaatgga
atgaaagggattggaaatcaatacaatgcaatgaatgtatcacctatgatgggtccaggt
ggtaataactcttacaatttccatgtgcctgcggcccatccatatggtggaatgaatttg
tcgaactccattgggatgatggggggtggtgtaggaaacgcccccgggatgggaggtggg
attttgcccgcaagtcccatgggcgacatgcacggagggatgatgggcgggttgatgagt
ggcccgcatggaagtatccctctggtgagcagttcgagtagagcaggcagtgcgacacaa
gttgcaggccccaagggaaacaaaaatgtaagctccaaaaatgtaaacaacaaatgtgta
aacaacaaaagtgtaaacaacaaaagtgtaaacaacaaaagtgtaaacaacaaaaatgta
gaagggaacacagcagaaactgaaagtgaaaaaaaaaaaaaagacacgcaatcaaagaat
aaaaatacaaataaaatgagtaccaatacagagagtagcaaaaacgtaattaaaaatata
cgaatggaggatctaacctttagtgaaaatatatatttaaaaaatgttgatggtcttgat
ctgagcaagaattttatcaatggaaaatactgctccaagttaccccccaatgaaaaaata
tataacattgttaattacattgtgaaaaattcccttgtggattacttattggatttttat
aacaacgacaatttgttttataatgagaagatcgacttgtcggatggcaacagtggggtg
gatagtggcccaaggacaggtgaacaagagacggagaaggagaaaaacggggaaaacaaa
aaagacgaagtgtgcaaagcagaggagactttgaatcatgataatgcgaaacaagaagtt
aagcatgaggacgacgaattcaagaaggaaaaggttgttgacagtgttaccccaacaggg
gaggctacttcagagaaccctggaggagaggcgaggaaagaaactgatgatgtgttgatc
ccagatgaagaactgaaaggtgaaagcaccccaagtatgacgaataagaagaatgcccca
agtgaaaacagcagtgttaataataggaatgagaagaaattcgatgcggtggaaatgaag
gaaagtgccaccattaatagtaatagcggcaatggtgaaaaaaacgttaatgacgaagga
gacgaaagcaataagtacatcttgatcgaaataacgaaaagcatatgctccataataaat
ctgcagcaactgatgccagtgaacaccagattaaacaacccgaatttaatttatgattct
aactatgaaacgatttattcaaagtggaaaagctttttgcgaaaagagcagtccagtggg
aatgttataagtatgtgtttctccagggattttctgcacagcgttcttttgtgtaattat
gtaaccataattgaggatttaaagaagactgccgtgaagaagaaaataaaattttttttt
ctgaacctttgtttagaggccgggctctccgtcaacatcgccctcatgctcttcatcaac
gcggccaagcagagcaacaaattacagtccctcctgccatctgaaaccggtcttggatat
ctgcatcgagacgcaggaggagccaaagaagaaaacatgggcatcatcaccttcgagtgc
ataacgaatgaccgggaacccgaccacttaatcaagctgatcacactgaaaaacattttt
tccaggcaactacccaagatgcctagagaatacatcgtgcggttagtgttcgaccggaat
cattacactttttgtcttttaaaaaagaatacggtaattgggggagtctgctttagaccg
tactttgagcagaggtttgctgaaatcgcctttctcgcggttacctccacggagcaggtg
aaggggtacggtactaggctgatgaaccacttgaaggagcacgtgaagaagttcggcatt
gagtactttttgacgtatgcagacaacttcgccatcgggtacttccgcaagcaggggttc
tcacagaaaatttccatgcccaaggagaggtggttcgggtacatcaaggattacgacgga
ggaacgttaatggagtgctatatattcccgaacataaattacctgcgcttatcggagatg
ttgtacgagcagaagaagacggtgaagaaggccattcattttattaagccacaaattatt
tttaagggactcaattttttttcacaaaataaaggagttaacagtgccatccacccaagt
aacatcccggggttactggaagtaggatggaaaaaggaagcgaagtattttccaaagaag
gcgcaaaacaaggaggtacaactgaaggatcaaattttaagcgtcttggacttcctcgag
aagcaacaatcggcttggcccttcctcaaacctgtgagcctgtctgaggcccccgactat
tacgacattataaaggagcccacagatattctgaccatgagaaggaaggcgagacatggc
gagtataaaacaaaggaagacttcggaatagagctaaagcgtatgttcgacaactgccgc
ctgtacaacgcgcccacgaccatctacttcaagtacgccaacgagttgcaggcgcttata
tggcccaagtacgagtgcataagtgatggaggaaaatga

DBGET integrated database retrieval system