KEGG   Plasmodium knowlesi: PKH_052050Help
Entry
PKH_052050        CDS       T01094                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PKH_052050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:join(906761..907045,907200..910364,910531..910587)
Genome map
AA seq 1168 aa AA seqDB search
MNPVCNNKLSIAAAEECKNEEMDREYYSCIKNCANDLQNLSLNFFPSINTYTCIPKINAI
NSITFHPCISSEDYFNNTYSFKPLFTHHFFSDSEQVIGFDSLQIDFYYTCDSYDVFMKIN
GSICDQYENSNYIMLMLLQNLYITTPYPGGFIETEEEFLKILRRNESTERNEQETTGKEK
TKATSINESDELEQEKIYKPPGFIIYEKKLCDDIYLQIRKCGFSSNYFKLDNINYMGGED
DDTEEAEEDDYENDVVVYQKGFTDTVRNENIDGVKNETSTKGGEINNTYVDANDNNNIKE
EFTNDPCEDERKGEGNEADTPKYITNDDNCVSSTISNELNKERTRIKSDPNTSFVDSCRV
SNEESTSNKEMIKKEKKENDVPQVGTEIDGFGCDDQKSPVESKKGKKNLTKYVTERDMSK
LYRHYLRIVRAKKRKNLIAKVDTQNEKTSPKKKLDKQKTSGGSAQGGVGVTATVSSGPQV
KEDEQGREPNQPSVTTQMSATTESTAVLDLSSPKKGTSVKGEISPNQSISPKKDGSPNEP
LDSSMPNQLNEKETNKRKKKNVREELVWAKYDYTVKNNFELLHRKVEWFYHWFIESASNI
EYDYRWSVILPYIVFKHGEKKKFTENKFIENLNVQLLNNRRTNVNVIPSIKLDPVSSPPS
TAMNNKEVPLPKGTEVEDGILKKHKRGAASSMKEKKDVKKRKKGQGGENAGEGNAEEEID
QRDENHEHVGQCESEEINDEQKGKEKDKIMVKKESEDNKKQIKNTKDNSKGEQIQVNYNS
EQMESTFDTNEYVLTSEIVIKAIENTLKDVRGKDEEEYYSFHKNYDVIYLYSDLEKGEGE
ASNVARDGTPCGVVDNVPAVPDVKGEKKTKGKKGLGTGRRKGIQQKEEEIVKDITNDQEK
GKKYNKNKYKSKGKNEKKSEEKMEGKNRNEKKSLYYFYLFGLATTYTFFTFQFDRNRISQ
FLIFPPMQSKGLGMKVLEKIYHLSIVNSNVKEITVEDPAVSFTQLRDIITIKMCIDLRIL
SPTILYPSDYLKTKNIDKEYVELDKKKFMKVCKETHKQITRMVETLLLAGVLPHPAPCYA
DTGEDKVTGIRKKEKKNEGPVCLNSMEHFESSDLCKDVRIKIKKRIKNDYIGNLINKNMN
CMASDVFQDYVKEELYKLWRKQCKVYYR
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgtgtgcaataacaaattatccatagctgcggctgaggaatgtaaaaatgaa
gaaatggaccgggagtattacagttgtataaagaactgtgccaatgatttgcagaatttg
tctttaaatttttttccctcaataaatacgtacacgtgcattcccaaaataaatgcgatc
aattcgataacgtttcacccatgcatttctagcgaagattatttcaacaacacgtactcg
ttcaagccattgttcacgcaccatttctttagtgacagcgaacaggttatcgggttcgac
agtctccaaatagatttctactacacatgtgatagttacgatgtatttatgaagataaat
gggtccatatgtgatcagtatgaaaattcaaactacatcatgctgatgcttttgcaaaat
ttatacattacgactccgtacccaggtgggttcatcgagacggaggaggagttcctaaaa
attcttagaagaaacgaatcgacagagcgaaatgaacaggaaaccacaggaaaagaaaag
accaaagcgaccagcatcaacgaaagtgatgaattagaacaagaaaaaatttacaaacct
cccggttttatcatttacgaaaaaaaactatgtgatgatatttatttgcaaataaggaag
tgtgggttctcttcgaattattttaaattggataatatcaactacatgggcggtgaagat
gacgatacggaggaagctgaggaagatgattatgagaacgatgtggttgtatatcaaaag
ggcttcacagatacggttcgaaatgaaaatattgacggagtgaaaaatgagaccagtacc
aaaggaggagaaattaacaacacgtacgtagacgccaatgataataataacataaaggag
gaatttacaaatgatccatgtgaggatgaaagaaagggtgaagggaacgaggctgacacg
ccaaaatacataacgaatgatgacaactgtgtaagtagcaccatatccaacgaattaaac
aaagaaaggaccaggattaagagcgacccgaacacttccttcgttgattcctgcagagta
agtaacgaggaatctacatctaacaaggaaatgataaaaaaagaaaagaaggaaaacgac
gttccccaagtaggtactgaaattgatggctttggttgtgatgatcaaaaatcccccgtt
gagtcgaagaagggaaagaagaacctcacgaaatatgttacggagagggacatgtctaaa
ctttatcgacattacttgcgcatcgtgagggccaagaagagaaaaaacctcatcgcaaag
gttgacactcagaacgagaagacctccccaaagaaaaaattggacaagcaaaaaacttca
ggaggatctgcgcagggaggcgttggtgtaactgcgactgtgtcatcggggccgcaggta
aaggaggatgagcaggggagagaaccgaatcagccaagtgtaactacccagatgagcgcg
actaccgaatcgacagcggttctggatttgagttctccaaagaagggaacttcagtgaag
ggagaaatttctccgaaccagtcaatatcaccaaagaaggatggttctccaaacgaacca
ttggattcctctatgccgaaccaacttaatgagaaagaaacgaacaaaaggaagaaaaaa
aacgttagagaagaactcgtttgggccaagtacgattacacagttaagaacaactttgag
ttgctccatagaaaagtggagtggttttaccactggtttatagaaagcgcctctaacatt
gagtacgactacaggtggagcgtcatactaccatacatagtgtttaagcatggtgagaag
aaaaagtttacagaaaataaattcatcgagaatttaaatgtgcagctacttaacaaccga
agaactaatgttaacgtcattcccagtataaagttggaccctgtatcctcccccccaagt
actgcaatgaataacaaggaagtgcctctccccaaggggaccgaagtagaagatggaatc
ttgaagaagcacaaacgaggagcagcaagttcaatgaaagaaaagaaggatgttaagaaa
aggaagaagggtcagggaggagaaaacgctggtgaaggaaacgcagaggaggagatagac
cagcgtgacgagaaccatgagcatgtcgggcaatgtgaaagtgaagagataaatgatgag
cagaaggggaaggagaaagacaaaataatggtgaaaaaggaaagtgaggataataagaag
cagataaaaaacacaaaggataatagtaaaggagagcaaattcaagtgaattacaacagt
gaacaaatggaatcaacgtttgatacaaatgagtacgtgctcaccagcgagatcgttatt
aaagcgattgagaatacgttgaaggatgtacgaggtaaggatgaagaggagtattattca
ttccacaaaaattacgatgtcatttatttatactccgatttggagaaaggcgaaggggaa
gcatcgaatgttgcgagggatggaacgccctgtggggtagtagacaatgtgccagcggta
ccagatgtgaagggtgaaaagaagacgaaggggaaaaaaggattaggcacaggaaggaga
aagggaatacagcagaaggaagaagaaatagtgaaagacattacaaatgatcaagagaaa
ggaaaaaaatataacaaaaataaatataaaagtaagggaaaaaatgaaaaaaagagtgaa
gaaaaaatggaaggaaaaaataggaatgaaaaaaaaagtttatactatttttatctcttc
ggattggcaacgacctacacgttctttacgtttcaatttgaccggaacagaatttcacaa
tttttaatttttccaccgatgcaaagcaaaggattgggaatgaaggttctagaaaaaatt
taccacttatctatagtaaattcaaacgtgaaggaaattactgtagaggatccagcggtg
tcattcacccagctgagggatatcatcaccattaagatgtgtatcgacttgaggattctg
agccccaccatcctctacccaagtgattatttaaagacaaaaaatatcgacaaggaatat
gttgagttggataaaaagaagtttatgaaggtatgcaaagagacacataaacagattact
agaatggttgagactttgttattggcgggtgttttaccacaccctgctccttgctatgcc
gatactggagaagataaagttacgggcattaggaagaaggagaagaaaaatgaaggccct
gtgtgcctgaattcgatggagcatttcgagtcatctgatttgtgcaaagatgtccgcatc
aagattaagaaacgcattaaaaatgattacatcgggaatttgataaataaaaatatgaac
tgcatggccagcgatgtgttccaggattatgtgaaagaggagctttacaagctttggaga
aagcagtgcaaggtatattacaggtga

DBGET integrated database retrieval system