KEGG   Plasmodium knowlesi: PKH_060480Help
Entry
PKH_060480        CDS       T01094                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pkn  Plasmodium knowlesi
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PKH_060480
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PKH_060480
   00020 Citrate cycle (TCA cycle)
    PKH_060480
   00620 Pyruvate metabolism
    PKH_060480
Enzymes [BR:pkn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PKH_060480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
6:join(195118..195360,195486..195552,195713..196105,196241..196320,196421..196458,196550..196645,196777..196857,196942..196996,197111..197199,197299..197737,197904..198215)
Genome map
AA seq 630 aa AA seqDB search
MILHWLSFLLCLRIYICISLPNKHGFISTLNHARASLLQSKGKNRRGVIFSQIEIKMPAL
SSTMTSGKIIKWNKDIGEYINLGDIIMTVESDKADMDVEAFDEGFLRVKHMGDGSEAKVG
DTLGILTTEKDEQIEARGDDSPTGITQQSSRKEQIDVVTQGNDTTETDTDSTTTQTTQEI
RGEEKIYVPFVSSKRNKMRIIKWTRKENDYVNKDEILFHVEDDKSTIEVESPYYGIIKEI
LVEEGQFADFDKPVAIISTIKAEEHPHKEQTPLENVQLVNEENILRHYQGTLSGTKEGKL
LLENMSSSDKQTMEERLLLNCDKYNNLSRDFFSSPRDDIPEESSKKQERDTAPPKGRDAP
VVLPSAAEMLEQNKLNPEDIKGSKIPGRITYEDVVSHLERTGGATPAKEKIIELTKVQKA
IKNNMLRTLSIPVFRITHFIKTNALLKLYEQVKDKISMTVLLSKCVSNVLLKHPLIYSTF
IDEGEGKILLNEDIHIGNALGLKSSLLTPVLKRVNKTDIYTLAAEWKKLVEKGKQGLLTL
GEMTGSNFYISNLGMFNTYQFDATLPANVSCILSVGTNIAGVENFEELKIQRGMMMTLTC
DHRHIYGSHAAAFMSDLAAFVERDIMQIFL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgatactgcactggctctccttccttctctgcctgcgtatctacatttgcatttctctc
cccaacaagcatggctttataagtaccttgaaccatgccagggcatctctccttcaaagc
aaagggaaaaacagaagaggggttatcttctctcagattgaaataaaaatgcctgccttg
tcaagtaccatgacatcaggaaaaattatcaagtggaacaaagacattggggaatacatc
aatcttggcgacatcattatgacggtagaaagtgacaaagcggatatggatgtagaggcc
ttcgacgaaggcttcctgcgcgtaaaacacatgggagacggaagtgaagcaaaagtcggg
gatacccttggaattctaaccacggagaaagatgaacaaatagaagctcgtggtgacgac
tcccccacgggaataacacagcagagttcgcggaaggaacagatagacgttgtcacgcag
ggaaacgacaccacagagacagacacagactcaaccaccacgcaaactacacaggaaata
aggggtgaggaaaaaatatatgtaccgttcgtaagtagcaagagaaacaaaatgaggata
atcaaatggactcgaaaagaaaatgattacgtcaacaaggacgaaattcttttccatgtg
gaagacgacaaaagtaccatagaagtggagagcccttattatggcatcattaaggaaata
cttgtcgaagaaggacagttcgcagattttgacaaaccggtcgccatcatctccaccata
aaagcagaagaacacccgcataaggaacaaacccccttagagaatgtccaactcgtaaac
gaagaaaacattttgaggcattaccagggaaccctcagcggaaccaaggaaggaaaactt
cttctggaaaatatgagctcctcggacaagcaaaccatggaagagcggctccttctaaac
tgtgacaagtacaacaacctttccagggacttcttcagttcgccccgcgatgatatacct
gaggaaagctcaaaaaagcaggagcgggacacggctccccccaaaggaagagacgcccct
gttgtgcttccctccgcagccgaaatgttggaacagaacaagctaaacccagaggacatt
aaaggatctaaaatacctggacgtataacatacgaagacgtggtttcacacctggagcgc
acaggaggagctacacccgcgaaggaaaaaataattgaactaaccaaagtgcaaaaggca
atcaaaaataacatgttgcgtaccctatccattccagtgttccgcatcactcattttata
aaaacaaacgctctcctaaaactgtatgaacaagttaaggacaaaattagcatgactgtc
ctcctgagcaaatgtgtgtcgaatgtattactgaaacatcccctcatttactcaaccttc
atcgatgagggagaggggaaaatattgcttaacgaagacattcacatcgggaatgccctg
ggattgaagagctctctcctgacgcccgtcctcaagagggttaacaagacggatatatac
accttggccgctgaatggaagaagctagtcgagaaagggaagcagggcctattgacgttg
ggcgaaatgactggtagcaacttctacatctccaacctgggcatgtttaacacttaccag
ttcgacgcgacacttcccgcaaacgtgtcgtgcatcctatccgtcggcaccaacattgct
ggcgttgagaattttgaagagctgaagatccagcggggaatgatgatgactctgacctgc
gatcatcgccacatttacggctcgcacgcggctgccttcatgagcgacttggcggcgttt
gtggagcgagacatcatgcaaatctttctgtaa

DBGET integrated database retrieval system