KEGG   Plasmodium knowlesi: PKH_061240Help
Entry
PKH_061240        CDS       T01094                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pkn  Plasmodium knowlesi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PKH_061240
Enzymes [BR:pkn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PKH_061240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
6:554242..556314
Genome map
AA seq 690 aa AA seqDB search
MSAQEGGAEGDEPGMAVEPGEANAPCGVSTPIRPEEDPPDEQQTYDVIIIGGGLFSCCLH
YFLKKKKPDIRILILEKEQTLGGYIKTECLEHQGKKFLCELGPNIFKTSDESYQLLKELN
LLSHVRVLNKNLLRYVYSGGKLHPLRLSIWGYFAFPLISAINKVKLIYKILFKRYKKLTA
YDEDISVEGYMRENFDLQHFNFLLLPLIYGSCGGMGNISAISFFSRNLKLFDNKLNKLRV
WQERMEHQRACQPPVWGRVSAVDSLRGGDVDSAAPLPNEEEPPNLQKHISINQQHSYAQG
MNQKHDSSSCFNNVLYRLDTSTGDTIAGDLIGESNTISETTGDHSSGSHQNNNPVNDKFT
TKHHAGMDTKKGQCDFEHTPFVKRIYEKCKCAILDAMLLFIPQLAKVGSIEYEQQQKKKI
LGKTISLKYGMYEIIDQLKKNINEKYVWTNEEVDFVEKHNEDTWVCTIKRKHASKTSCIY
GRNIILTVNSKICANIMRKILPPEMKANLVNVQYTSIISVTVYYHKKDIILPPNCFGFLS
ADKTNHILGCFYTSNMFKERCNDDSIVVLTLYMGGKNNPNDVYMEEKDIIKIISEELTNI
FHVENNAQPVILKMKKWFDSIPFYSLNYERNLKRFLNELNNPQYRNLFVDSGWITGTSIS
DRIASARDLSEFMASSVFTMKTQCANPVLA
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgcaagaaggaggagcagagggggatgaacctggcatggcagtggagccaggc
gaggcaaatgcgccatgtggggtaagcactcctataaggccagaggaggatcctccagac
gagcaacagacatacgatgtcatcatcataggagggggcctcttcagttgttgcctgcac
tattttctaaagaaaaaaaaaccagacataagaatcttgatattggaaaaggagcaaaca
cttggaggttatataaaaacagaatgcctagaacaccaagggaagaaattcctctgcgag
ttgggcccaaatatttttaaaacatctgacgagagttatcagctgttaaaagaattaaac
ctgttatcacacgtaagggtgctaaataaaaatctactaaggtacgtatactcaggtgga
aaactacaccccctccgtctaagtatttggggttactttgctttcccccttataagtgct
atcaataaagtgaaactaatatataagattctattcaagaggtacaaaaaattgacagcc
tacgatgaggacattagtgttgaaggatacatgagggagaatttcgatttacaacatttc
aactttttgttactacctctgatttatggatcctgtgggggcatgggcaacatttcagcc
atctcctttttttcgcgcaacctcaaattgttcgataataaactgaacaagttacgcgtc
tggcaggagcgcatggagcaccagcgcgcatgccaaccgcccgtgtgggggagagtatct
gcagtggatagcctaaggggaggtgacgttgactcagccgctcctctccccaacgaagaa
gaaccgccaaacttacagaaacacatatccataaaccaacaacactcctatgcgcaagga
atgaatcagaagcacgactcctcctcctgcttcaacaacgtgttgtacagactggacaca
tccaccggggataccatcgcgggggacttaattggcgagtcgaacacaataagcgaaacg
accggcgaccactcgagtggtagtcaccagaataacaacccagtgaatgacaaattcaca
actaaacaccacgcagggatggacaccaagaagggtcagtgtgatttcgagcacacaccc
ttcgtaaagcgaatctatgaaaagtgcaaatgcgccatcctggacgccatgctgttgttc
attccccagctagccaaagtgggctccatagaatatgagcaacaacaaaaaaaaaaaatc
ttaggaaaaaccatatccctgaaatatggcatgtacgaaataattgaccaactgaaaaaa
aatataaatgaaaaatatgtgtggacaaatgaagaagtagattttgttgagaagcacaac
gaagatacttgggtgtgcaccatcaagagaaaacatgcaagcaaaacctcttgtatatac
gggagaaatatcatccttacagtgaactccaaaatatgcgccaatatcatgcgcaaaatc
ttgcctccagaaatgaaggccaatcttgtaaatgtgcaatacacaagtatcatcagcgtt
acagtgtattaccataagaaggatataattctaccgccaaactgttttggatttttgtcc
gcggataagacgaatcacattctggggtgcttctacacgagcaacatgttcaaggaaaga
tgcaatgacgacagcattgttgtattgaccctctacatgggggggaagaacaaccctaat
gatgtatacatggaggagaaagatataatcaaaataatctcggaggaattgacaaatata
tttcatgtagagaacaatgcccaacctgttatcctcaagatgaaaaagtggtttgactct
atccccttctattcactcaactacgagaggaatttgaaacgttttctgaacgagctgaac
aaccctcagtaccggaacttatttgtcgattcgggttggattacggggacatccatttct
gacaggattgcttcggcgagggacttgtcggagtttatggcttccagcgtcttcactatg
aagacgcaatgcgccaatccggtgttggcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system