KEGG   Plasmodium knowlesi: PKH_062270Help
Entry
PKH_062270        CDS       T01094                                 

Definition
erythrocyte binding protein
Organism
pkn  Plasmodium knowlesi
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:join(1013203..1013403,1013611..1015539)
Genome map
AA seq 709 aa AA seqDB search
MFGKKYKMLHKMSKHGKKENSPENSITADIETFKKSERKGVLNKCFFLLNIFIVSFLIWN
LQNPNSSCTSDESCVSSNVVRMNPLSNGNRVLLETEQIDRMSYDDNSAVSSPGQQHFRGS
NIKPDFSKLGTELNGNEERMNEEMNTNHKTEKTNFKDHFPKEEKRTNQNNGEENTNIYND
VQDIYNAYNNVNNDLNSSQGNEPFISNTNKANVDREGNYDKEEGENESGSNEPKEQDDLG
KDEEGDEDGMEEDKKEENGEDKEGDQGKDEGKEDNREDDKDDKDKGKKDKDDDDDDDNDD
DDNDEEDDGSDDDNNDDDDERKKAKDEEEFAGKNCVKGGCLFMDDNTENKGCTFKDNCRK
KDDSTVKSECPCKDKSVEKEQCTESGECSKNYGCAFKEQKKGNEGHLRKDKFAGKDSGEF
ERCPFTGICLKKYRCSSKDNDAEKEDCAKKTGCPYMKQVCSGKKECPFKAQNSESDKCAG
KKECPFKAQNTESDKCAGKKECPFKAQNTESDKCAGKKECPFKAQNSESDKCAGKKECPF
KTQNTESDKCAGKKECPFKAQNSESDKCAGKKECPFKAQNTESDKCAGKKECPFKAQNSE
SNKCAGKKECPFKAQNSESNKCAGKKECPFKAQNSESDKCAGKKECPFKAQNSESDKCAG
KKECPFKTQNSESNKCAGKKECPFKAQNSESNKCAGKKECPFKGGCEKK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaaatataaaatgttacataaaatgtcgaaacatgggaaaaaggaaaat
tcaccagagaattctataactgctgatattgaaacgtttaagaaatctgagcgtaaaggt
gtactaaataaatgttttttcctccttaatatttttattgtttcatttttaatatggaat
ttacagaaccctaatagtagttgcacctctgatgaatcgtgcgtttccagtaatgttgtg
cggatgaatcccctgagcaatggtaatcgagtgttactggaaactgagcaaatcgataga
atgagctatgatgataattctgcggtgagttctcctggtcaacaacacttcagagggagt
aatataaaaccggatttcagcaaattaggaacggaattaaatggcaacgaggaaagaatg
aatgaggaaatgaacacaaatcacaagacagagaagacgaattttaaggaccactttcca
aaagaggaaaagagaacaaatcaaaataatggagaggaaaatacaaatatttataatgat
gttcaagacatttataacgcatataataatgtgaacaatgatttgaattcctcccagggg
aatgagccttttatttccaatacaaataaagcaaatgtggacagggagggaaactacgat
aaggaagagggagaaaatgaaagcggtagcaatgaacccaaggaacaggatgatttaggt
aaggatgaggagggcgatgaagacggcatggaggaagataagaaagaggagaacggagaa
gataaggaaggagaccaaggaaaggatgagggaaaagaggacaacagggaagatgataag
gacgataaggataagggtaaaaaggataaggatgacgatgacgatgatgacaatgatgat
gacgacaacgacgaagaagatgatggtagtgacgatgataataatgatgatgatgatgaa
agaaaaaaagcaaaagatgaagaagaatttgcaggaaagaactgcgtaaaaggtgggtgt
ctatttatggatgataatacagaaaataaaggatgtacttttaaggataactgccgaaaa
aaggatgactctacagtaaaaagtgaatgtccatgtaaagacaagtctgtagaaaaagag
caatgtaccgaatcaggcgaatgttcaaaaaattatggatgtgcctttaaagagcagaag
aagggaaatgaaggacatctacgtaaagataagtttgcaggaaaagattctggcgaattc
gaaagatgcccatttactggtatatgtttaaaaaagtatcgatgttcatccaaagataat
gatgcagaaaaagaagattgtgcgaaaaaaacgggatgcccctatatgaagcaagtatgc
tccggaaaaaaagagtgcccatttaaagctcaaaattctgagagtgacaaatgtgccgga
aaaaaagagtgcccatttaaagcccaaaatactgaaagtgacaaatgtgccggaaaaaaa
gagtgcccatttaaagcccaaaatactgaaagtgacaaatgtgccggaaaaaaagagtgc
ccatttaaagcccaaaattctgaaagtgataaatgtgccggaaaaaaagagtgtccattt
aaaactcaaaatactgaaagtgacaaatgtgctggaaaaaaagagtgtccatttaaagct
caaaattctgagagtgacaaatgtgccggaaaaaaagagtgtccatttaaagcccaaaat
actgaaagtgataaatgtgccggaaaaaaagagtgtccatttaaagcccaaaattctgaa
agtaacaaatgtgccggaaaaaaagagtgtccatttaaagcccaaaattctgaaagtaac
aaatgtgccggaaaaaaggagtgtccatttaaagctcaaaattctgagagtgacaaatgt
gccggaaaaaaagagtgcccatttaaagctcaaaattctgagagtgacaaatgtgccgga
aaaaaagagtgcccatttaaaactcaaaattctgaaagtaacaaatgtgccggaaaaaaa
gagtgcccatttaaagcccaaaattctgaaagtaacaaatgtgccggaaaaaaagagtgt
ccatttaaaggagggtgtgaaaaaaaatga

DBGET integrated database retrieval system