KEGG   Plasmodium knowlesi: PKH_070380Help
Entry
PKH_070380        CDS       T01094                                 

Definition
Arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pkn  Plasmodium knowlesi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PKH_070380
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PKH_070380
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PKH_070380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
7:214994..216103
Genome map
AA seq 369 aa AA seqDB search
MIECIENYLKTFKEKENMYVKKKVSIIGSPLSAGQPLGGVNLACDNLRMLGLHKVIDSLG
WSYEDVGNVGTGGSVSSVGSTVGEDNDNSQNHIDINDHKGGGCMTKKCVQNNYYNNIKNV
DIVGKFSEELFYAMSKELRKKNFVLNIGGDHSVAFPSILSALQFYPDLRVIWIDAHGDIN
IPETSPSGNYHGMALAHTIGLFKNRVPCFEWSENLTYLKPENVAIIGIRDIDIYEKIILK
KCNINYYTIFDIEKNGIYNTICTALKLLDPHEEFPIHVSFDIDSVDSFFAPGTGTIAKGG
LNYREINLLMKVLADTKRVVSMDLVEYNPSLDENDKKVHGDSLPISEYATKTGKLCLELI
ARVLGNDIV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatgtatcgagaattacttaaaaacttttaaggagaaggaaaacatgtatgtg
aaaaaaaaagtgtccatcattggatcgcccctgtcggctggacaacccttgggaggagtg
aacctggcttgtgataatttaaggatgctcggtttgcacaaggtgatagattccttggga
tggagttacgaagacgttggaaatgttggtactggcggaagtgtgagcagcgttggaagt
actgtgggcgaagataatgacaattcgcaaaatcatatagacattaatgatcacaagggg
ggaggatgcatgacgaaaaagtgcgtacaaaacaactactataataatataaaaaatgtt
gatattgttggaaaatttagtgaagaactattttacgcaatgagtaaagaattgagaaag
aaaaattttgtattaaacattggaggtgaccacagcgttgcatttcctagcattttgagc
gctttgcaattttacccagatttaagagtgatatggatagatgcccatggagacattaac
atcccggagacctctccctcaggaaattatcatggcatggctttagctcacactataggg
ctctttaaaaacagagtgccatgctttgaatggtctgaaaatctaacatatttaaaacca
gaaaatgtcgctatcattggaatacgagacatcgatatatatgagaaaattattttaaaa
aaatgtaacattaattattatacaatctttgatattgaaaaaaatggcatatacaatacc
atctgtacagctcttaaactgctagatccccatgaagaattcccaatacacgtttctttc
gacattgatagtgttgatagtttttttgctccaggaactggaaccattgccaagggggga
ctaaattacagagaaattaatttattaatgaaagttctggcagacacaaagcgcgtcgtt
tcaatggatttggtagaatataacccatctctcgacgaaaatgataaaaaggttcacgga
gattccttacccatttcggagtatgccacaaaaacgggaaagctttgtctggaacttatt
gccagggttctcggcaacgacatcgtctag

DBGET integrated database retrieval system