KEGG   Plasmodium knowlesi: PKH_070970Help
Entry
PKH_070970        CDS       T01094                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pkn  Plasmodium knowlesi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PKH_070970
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PKH_070970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
7:complement(join(485066..485677,485884..486609))
Genome map
AA seq 445 aa AA seqDB search
MKNCVILLFLFCACIKYVSCHADQIINEKLTNLVFLSCNYHKGKTNDKLIKSVEKKKPQL
MLWVGDYFYSECKDLKCLYEAYDYIKKDPFYIGLKEKFVIDGIYDDHDYNKNNGDRLYEH
KKESKTQFLNYMNVPKNDVRYKRNGAYISKLYIDPENEKNQVKIIILDTRYNKDPYPFYA
PDSYHDSFMHMFVSFVVRFHAALFGLYCDSKNDILGNEQWAWLEKELTNSSARAHIVISS
TQIFSNHIVNENWGLMPFAQKKLKHLMNKTKPKGLIFLSGDVHFASILGNEENVVEVTSS
SVNQENIFSYINKYFIYFSTYFLNKKSPFELDKIFAFNNFGSLSISYINDDEIRIKSVIH
DSDGNEILVANQSFNKKKNAYKKTQNLHLLHDDIATFSCKSNSKVCIHIIIYVLFVLWFL
QIIFIFCKLLGFCKKKKVADKRKGE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtaattttactttttcttttttgcgcatgtatcaaatatgtgagttgc
catgcggatcaaataattaacgaaaaattgacaaacctggtttttttgagttgtaattac
cacaaggggaagacaaatgataagctaataaaatcggtggagaagaagaagccacaactt
atgctctgggttggagattatttttactcagaatgtaaagacctgaaatgcctgtacgaa
gcgtatgattatattaagaaagatcccttctacatagggttaaaagaaaagtttgtaatt
gacggcatatatgatgatcatgattataataaaaataatggagatcgactgtatgagcat
aagaaggaaagcaaaacgcagttcttaaactatatgaatgtaccaaaaaatgacgtgagg
tataaacggaatggtgcatatatttcgaaattgtatatagacccggagaatgaaaagaat
caagtgaaaattatcattttagacacaagatataacaaagacccataccccttttatgcg
cctgactcataccatgacagtttcatgcacatgttcgtctcgttcgttgttcgctttcac
gctgctctgtttggtctatattgcgatagcaagaatgacattttgggcaatgagcaatgg
gcatggctggagaaggagctcaccaactcgagtgcgcgcgcgcacattgtcatttcgtcc
acgcagattttctccaaccatatagtgaacgagaactggggattaatgccattcgcccag
aagaaactaaaacatttgatgaataaaaccaaaccaaaggggttaatcttcctaagtggt
gatgtacactttgcaagcatacttggaaacgaagaaaatgtggtggaagtcacgagcagt
agcgtaaatcaggaaaacatatttagctacatcaacaagtatttcatttatttctccact
tattttttgaacaagaagagtcccttcgagttagacaagatatttgcgtttaacaatttt
ggctcacttagcatatcatacataaacgacgatgaaataagaataaaatccgtaattcat
gactcggatggtaatgaaattttagtggccaaccaatcttttaataaaaagaaaaacgcg
tataaaaaaacacagaacttacatttattgcatgatgacatagcgacgttttcgtgtaag
agcaattcaaaggtgtgtatacacatcataatttacgtactgtttgtgttgtggtttttg
caaattattttcatcttttgcaagctgctcggattttgtaagaaaaagaaggtcgcagac
aaaaggaagggtgagtaa

DBGET integrated database retrieval system