KEGG   Plasmodium knowlesi: PKH_071270Help
Entry
PKH_071270        CDS       T01094                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00895  
diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
pkn  Plasmodium knowlesi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PKH_071270
   00030 Pentose phosphate pathway
    PKH_071270
   00051 Fructose and mannose metabolism
    PKH_071270
Enzymes [BR:pkn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     PKH_071270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(592928..597181)
Genome map
AA seq 1417 aa AA seqDB search
MSNFNVKDEEAKKPSMDGLVKSMSVLLKDNECAFNLEEQENQQSPDQKPQDKKDSEMIDC
LMQKLTSKKFLVEKETKNSFYLVDNENMKIKKLKEHGHSASLNDDLSPLQYERIKYQPTL
PKALASEYQVLEENHGDDFINKKDYEEVKKFLKNLHNLPILNVKETNNHESFKGGNVLKI
GIILSGGPAPGGHNVISGIYDYAKRYNEQSQVIGFLGGIDGLYSKNYVTITDSLMNRFRN
LGGFNMLWSGRGKVRNKDDLISIENIVAKLKINGLVIIGGDGSNSNAALISEYFAERKIP
ISIIGIPKTIDGDLKSEAIEISFGFDTATKTYSEVIGNLCTDVKTGNNVYHVVRVMGRSA
SHVVLECALQTRPNIVLIGEEVEKENLSLKDIVSNIVNTILKRRTLNKNYGVILIPEGLI
EFVPEMKILIGELNVILKEGPFDANKLKHSREVWDFLPSIIQDQLLMDRESTGYIQVGKI
ATERLIIVLVESELAKLKDNNLNIQFMAHYLGYEGRCAIPSNFDCNYCYALGYNAALLID
HKKTGYMSIIQNLEDSYANWIPAAIPFLRIMHVNRDNTGKEFPAVKRYLVDLNSPLFNVL
KEVRNLWSLYDLYRSPGPIQFNGHLSNSRCYTVKIPTKNILLCQNSDDLQLIINLANKKN
HAGGYSNGGSDEEEGDNQMDLSGISVNSQSKGNELGAVTATPKGVHEKNLSEDMKQVGDD
SGIAAGKTILPDLVSEENGNASNVENGLYEQHCSSYKSLGCMSELQTSRLYNKLMLPELC
TDLKAKVRAGKQYISSDPYTQKQILSNYPHMSYENKFQIQEIFHDKYATPISFEIKIGIV
FLSRQAPGAMNVLCGLYQRLKLLKGVCIAFYGLYGLLNNKYIIIDDDNIAKHMNQGGLEL
TGNSPEHSLFDKESRNKVCETVTNLQLNGLVMPGSNVTITEAALLAEYFLEKKIPTSVVG
IPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSMPKYWHFIRLMGRSPSHEVL
ECALQTHPNMVIISEEYGAADKTLWRVVQDIADVVCARAELGKNYGTVLIPDALLMHLPH
MKILLSEISDILNDANEKGQLVQARKDLVNLSTTQNGTVGATSGAAAGEGQPLSASPWVE
KLTPWSLALLKTFPQFIIKELLHVDLRSMRFEKLETEQLLLQMVKEELHQRKQKGKYSGS
FMGLTHFFGYQGRSSLPSEFDCKLAYSYGHAASIVIESGLTGYIVSIRGLCGNIKDWKLF
AIPFISLMKILPRGQDSKYLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRFC
NPGPIQFEGNASNYYNRILFEEQSEYFEMLRYVECYANILKDTCRFGVSADYLKNVFVQL
CGMLVLAYKPNDILSNMPYIGSIEDYYDWENQRKRMD
NT seq 4254 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacttcaacgtcaaagacgaagaggccaaaaagccatccatggatggcttggtc
aaaagcatgtccgtgttgctaaaggacaatgaatgcgctttcaatttggaagagcaagaa
aatcaacaaagcccagatcaaaaaccacaggacaaaaaagacagtgagatgatagactgt
ttaatgcaaaagctaacctcgaaaaagttcctagtcgaaaaggaaacgaagaactccttc
taccttgtagataacgaaaatatgaagataaaaaagctaaaggaacatggccattcggca
tccctaaatgatgatttaagccctctacagtatgaaaggataaagtaccaacctacctta
cccaaggcactcgcaagtgagtaccaggtgttagaagaaaaccacggggatgattttatt
aataaaaaagattatgaggaggtgaaaaaatttttaaagaatctacataacctgcccatt
ttgaacgtgaaggaaacgaataaccatgaatcttttaaaggaggaaatgtattgaaaata
ggaattattttatctggtggtcccgcaccaggtgggcataacgtcatatcgggtatctat
gactatgccaaaaggtacaatgagcaatcacaggttattggttttttaggaggaatagat
ggattgtatagcaagaattacgtgaccattacagattctttgatgaatcgatttcgtaac
ttgggagggttcaacatgctgtggtcaggtcgagggaaggtaaggaataaggatgacttg
atttccatagaaaatatcgttgcaaagttgaagataaatgggttggtaataattggaggg
gatggatccaacagtaacgcagcattgatatctgagtactttgcagagaggaagattccc
atctctattatcggtatccccaaaacgattgatggggatttaaaaagtgaagcaattgaa
attagctttggattcgatacagcgactaagacctattcagaagtgataggaaatctatgt
acagatgtaaagacaggaaataatgtataccacgtcgtgagggtgatgggaagatcagca
tcgcatgtagtattggaatgtgctctgcagacaagacctaatatagttctcataggggaa
gaagtagagaaggaaaatttatctctaaaggatattgttagtaacattgtaaatacaata
ctgaaaagaagaacactaaataaaaactatggagttattttaattccagaggggttaatc
gaatttgttcctgaaatgaaaattttaattggagagttgaatgtcattttgaaagaaggt
ccatttgatgcgaacaaattgaaacactctagggaggtctgggatttcttacccagtatc
attcaggatcagctattaatggatagggaatctactggatatattcaagttggaaaaata
gcaacggagaggttaatcattgtacttgtagaatctgagctagctaaattgaaggacaat
aatttaaatattcagtttatggctcactatttaggatacgaaggaaggtgtgccattcca
tcaaattttgactgcaactattgctatgcccttggatacaatgctgctttgctaattgat
cataagaaaacaggatacatgtccattatccagaatttagaagattcctatgccaactgg
attcctgcagccattccctttctgcgtattatgcatgtgaatagagacaacacaggaaag
gaatttcccgctgtgaagaggtacctcgtagatttgaatagcccacttttcaacgtattg
aaagaagtacgcaatttgtggtccctgtacgatttgtatagatctcctgggccgattcaa
tttaatggccatttgagtaactccagatgctacacggtgaagatacccacgaagaacata
ctgctatgccagaattcggacgacttgcagttgattattaatttggctaataagaagaat
catgctgggggatatagcaacggtggttcggatgaggaggaaggggacaaccagatggat
ctgagtggcatttccgttaattcgcagagcaaaggtaacgaacttggtgcagttactgcg
acacctaaaggggttcacgaaaagaatctatcggaggatatgaaacaagtgggagatgat
tctggaatcgccgcaggcaagacgattttacctgatctggtaagcgaagaaaatggtaac
gcaagtaatgtggaaaacgggttatacgaacaacactgctccagttacaaatccctaggt
tgcatgtcggagttgcagacctccaggctgtacaacaagttgatgttgcctgaactatgc
acagatttgaaggcgaaagtgagggcaggaaaacagtacatatcgagtgacccgtacaca
cagaagcagatcctgtctaactaccctcacatgtcatatgaaaataagtttcaaatacaa
gaaatttttcacgacaaatatgccactccgatatcgtttgaaataaaaataggaattgta
tttttatctagacaagcaccaggagctatgaatgtactatgtggtctctatcagcgcctc
aagttgctaaaaggggtatgcattgccttttacggtttgtatggtttattaaataacaaa
tatatcattatagatgacgacaacatagctaagcacatgaaccaaggagggttagaatta
actggaaattcaccggagcattctttatttgataaagagagtcgaaataaggtttgtgaa
acagttaccaatttgcaactgaacggtttggtgatgcctgggtcaaatgtcaccattacg
gaagcagcactcttggcggagtatttcctggagaagaagatcccaacttctgttgtgggt
attccattaacaggttctaacaatttgattcacgagctgatagaaacatgtgtaggtttt
gatagcagtacgaaggtgtatgcctccctcattggaaatgtccttacagatgcagtcagt
atgccaaagtattggcacttcattcgtcttatgggaagatccccgtcacatgaagtgttg
gaatgtgctctgcagacacatcccaatatggtaataatatcggaagaatatggagcagct
gataaaacgctttggagagtcgtccaggatattgcagatgttgtttgtgcaagagccgaa
ttgggaaagaattacggaacggtattaattcctgatgcgctgctcatgcatcttccacat
atgaaaattttacttagcgaaataagtgatattctaaacgatgcaaatgaaaaagggcaa
ttggtccaggcaaggaaggacttggtgaatttgtcgacaacgcagaatggaacagtgggg
gcaacatcaggagcagcggcaggggaaggacaaccactgtctgcttctccatgggtggaa
aaattgactccatggagtttagcccttctgaagactttcccacaatttatcattaaagaa
ttattgcatgtagatcttagatccatgagatttgaaaagttagagacagagcaattgctc
ctacaaatggtgaaggaagagctccatcagagaaaacaaaagggaaaatattctggaagc
ttcatgggattaactcacttctttggctaccaaggtcgttcatcattgccatctgaattt
gattgtaagttggcatattcctatggccatgccgcttccattgtgattgaaagtggactt
acaggatatatcgtttcgataaggggtctgtgtggaaatataaaagattggaaattgttt
gcaatcccctttatatctttgatgaaaattttgcctcgaggacaggacagtaaatatttg
aagagcgcctcgaagggagatctccccgtcattcctagtgcccccgttgacttgaacggc
aaagcgtatagaagcttaaaaattgctttgcaaaaatggcagatggaagataggttttgt
aatcctggacccatccagtttgaaggaaatgcgtcgaattattacaaccgcattttgttc
gaagagcagtccgagtactttgagatgctacgctatgtggaatgctacgcgaatatactg
aaggacacctgtcgtttcggtgtgtcagctgattatctaaaaaatgtgtttgtccaacta
tgtggcatgcttgttctggcgtacaagccaaacgacattctctccaacatgccctacatt
ggaagcatcgaggattactacgattgggagaatcagcgcaagcggatggactag

DBGET integrated database retrieval system