KEGG   Plasmodium knowlesi: PKH_072040Help
Entry
PKH_072040        CDS       T01094                                 

Definition
nadph-cytochrome p450 reductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PKH_072040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
7:890042..892249
Genome map
AA seq 735 aa AA seqDB search
MIRRSSRLLLQGSIFCACALFLAWKTRHATLFQKVTNIVRRCLRLKSQRDIETNEQIRNN
VKIYFGSQGGTAEQFSKELSENLRDIFNIKAEVIDLEYFNKDEISKFGVRIFIVATYGDG
EPTDNACAFFKWLKNLNDDNEYFRNTIYSIMGLGSKQYKHFNKVAKKLANYLTKFKATQI
SENVFGDDDDNIYQDFEIWKREFFKELVKMLHMKEDIIPVQFFSENVVELVDWTTLPEIN
LRIRYGEEATDEGALPHGMEQAHPGKTETIILPHQTTDITGKFYFNHHTGRVMSNENLLK
HVNHTSDDDKVNRIVISVEKVSFKAADTLVVLAKNPNEIISWWLKRLRIDDTDRKKRFTF
VSKDTTENRSQESQENGSNLNTLQSSILQENTPVCVPFPTPCTVEDALAYYCDLTTIPRV
NILKKFKCFIKDVEELKMFNYILSNKQRSTFFNICKESDMTLIEFVDIFMPKAEFELTPF
LQLIPRNVPKSYTISSSPKEGEDTISLTVKKKQYPIHSLRKALKEFKNNDMLPPISEQKL
RELCSRRWFKGSSSFYLTEELTPHDSVKFNLKSSKFCLPPYLESTNIIMVATGTGIAPFK
AFITEFKHFDQTCVYNGVAKKAKRILFFGCRKREIDFLYEREISEAVEGKHIDEVFLAFS
RDQHEKVYVQDLILERKDLVWSLIQKGAYIYVCGNNNMSKDVNKTINSLPMHYKQNNKKF
TKSLKKAGRYVEEMW
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggcggtcaagcaggctccttttgcaggggtccattttctgcgcctgtgcattg
ttccttgcctggaagaccaggcatgctaccctctttcaaaaagttacaaatatcgtaaga
agatgcctccgattgaaaagtcaaagggacattgagacaaacgaacaaattaggaacaac
gtgaagatctactttggcagccaaggaggaacggcagaacagttttccaaagaactgagc
gaaaacctaagagatattttcaatataaaagcagaggtgatcgacttggaatatttcaac
aaggatgaaatatcaaaatttggtgtgcgcatattcatcgtagctacttatggagatgga
gaacccacagacaatgcatgtgccttttttaagtggctcaaaaatctgaatgatgacaat
gaatattttagaaacaccatatattccattatgggattaggaagcaaacaatataagcat
tttaacaaagttgcaaaaaagctagccaactatctcaccaaatttaaggcaacacagatt
agcgaaaatgtgtttggggatgatgatgataatatttatcaggattttgaaatttggaaa
agggaattttttaaagaacttgtcaaaatgttacatatgaaggaggatattattccagtg
caatttttttcagaaaatgtggtcgagttggtggactggacaactcttccagaaataaat
ctgcgtattcgatacggagaagaagcgacagacgaaggtgcgttaccacatgggatggaa
caagcacatcctggtaaaacggaaacaataattttgcctcaccaaacgacagacataacc
ggtaagttctactttaatcatcacacgggaagggtcatgtcgaatgagaacctgttgaaa
catgtgaaccatacttctgatgatgataaggtcaatcgtatagttatctctgtggagaaa
gtctccttcaaagcagctgacacgttggttgtgttggcgaaaaacccaaatgaaatcatc
tcctggtggttgaagcggttaaggatagacgatacagataggaagaagagatttaccttt
gtgtctaaggatacaacagagaatcgatcccaagaatctcaggagaacggttcgaatttg
aataccttacaaagtagtattcttcaggaaaacacccctgtatgtgtccccttccccacg
ccatgcaccgtggaagatgcactggcatactactgtgacttgacgaccataccgagggta
aacattttaaagaagttcaagtgcttcatcaaagatgtggaggaactcaaaatgtttaat
tatatcctttccaataaacagagaagtacgtttttcaacatttgcaaagagtcagacatg
acgttgattgaatttgtcgacatattcatgccaaaagctgagttcgaattaaccccattt
ttgcaactaattccaaggaatgttccaaaaagttacaccatttcttcatcccccaaggaa
ggggaagatacgatctctttaaccgttaagaaaaaacagtaccctattcattcccttcgt
aaggctctgaaagagtttaaaaataacgatatgcttcctccaataagtgagcagaaatta
cgagaactttgcagcagacgatggtttaaaggttcgtcctccttttatctaacggaagaa
ttaaccccacatgatagcgtaaaatttaatttaaaatcttcaaaattttgtttgcccccc
tatttggaatcgactaatattatcatggtcgccactggaacgggcattgcgcccttcaaa
gcgttcataacggaatttaaacattttgaccaaacgtgtgtgtataatggagtagctaag
aaggccaagcgaatcctcttcttcggatgcagaaagagagaaatagacttcctctacgaa
agggaaatttcagaagctgtggaagggaagcatatcgatgaagtgttccttgctttctca
agagatcaacatgaaaaggtttatgtgcaggatttaattctggaaaggaaggatcttgtc
tggagtttgatacaaaagggagcctacatctacgtatgtggaaataacaacatgagcaaa
gatgtgaacaaaacgattaacagcttgccgatgcattacaaacaaaacaataagaaattt
accaaaagcttgaagaaggccgggaggtatgtggaagaaatgtggtga

DBGET integrated database retrieval system