KEGG   Plasmodium knowlesi: PKH_072280Help
Entry
PKH_072280        CDS       T01094                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PKH_072280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(977886..979232)
Genome map
AA seq 448 aa AA seqDB search
MSNRKKVAYFHDPDVGSYYYGAGHPMKPQRIRMTHSLIVSYNLYKYMEVYRPHKSDVNEL
TLFHDYEYVDFLSSISMENYRDFTCQLKRFNVGEATDCPVFDGLFQFQQSCAGASIDGAS
KLNHHCADICVNWSGGLHHAKMSEASGFCYINDIVLGILELLKYHARVMYIDIDVHHGDG
VEEAFYVTHRVMTVSFHKFGDYFPGTGDITDIGVHHGKYYSVNVPLNDGITDDAFVDLFK
AVIDKCVQTYRPGAIILQCGADSLTGDRLGRFNLTIKGHARCVEHVRSYNIPLLVLGGGG
YTIRNVSRCWAYETGVVLNKHHEMPDQISLNDYYDYYAPDFQLHLQPSSIPNYNSPEHLS
RIKIKIAENLRNIEHAPGVQFAYVPPDFFDSEIDDECDKNQYELKDDSGGGRAPGTRSKE
HSTTHHLRRKNYEDDFFDLSDRDQNIVL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccggaagaaggtggcatacttccacgaccccgatgtagggagttattactac
ggagcaggccatccgatgaagccacagagaatccgaatgacacactcgctaatcgtgtcg
tacaatttatacaaatacatggaggtgtacagaccacacaagagtgatgtgaacgagttg
actctcttccatgattacgaatatgtagatttcttatcttccatttccatggaaaattat
cgtgatttcacatgccaattgaaacgtttcaatgtaggagaagcgacagactgtcctgtc
tttgatgggttattccaatttcagcagtcgtgtgcaggtgcatccatagatggagcttct
aagctgaaccaccactgtgctgatatctgtgtaaattggtctggaggattacaccatgca
aagatgtcagaagctagtggcttctgctatattaacgacatagttctaggtattcttgaa
ttgctgaaataccatgcacgggtgatgtacatagatatagatgttcaccacggggatggt
gtagaagaagctttttatgttactcatcgggttatgaccgtatcctttcataagtttgga
gattattttcctggcacaggagatattaccgatatcggagtacatcatggaaagtattac
agtgttaatgtgcccttgaatgatggcataacggatgatgccttcgttgatttattcaaa
gcggttatagataaatgtgttcaaacatacagaccaggggcaattatactacagtgcgga
gcggatagtcttacaggtgacagattaggaagattcaatttaacgataaaagggcatgcc
agatgtgtggagcatgttcgatcgtataatatacctctccttgttttaggtggaggagga
tataccattagaaatgtatcaaggtgttgggcgtacgaaacaggtgttgtcttaaacaaa
caccatgaaatgccagaccaaataagcttgaatgactactacgattattatgctccagat
ttccaactacatctgcaaccatcgagtatacctaattataactctcctgaacacttgagt
cgcataaaaataaaaattgcggaaaatttgcggaacatagaacatgcaccgggggttcag
tttgcctatgtacctcccgacttcttcgattcagaaattgatgatgagtgtgataaaaac
cagtatgagttgaaggatgatagtggcggaggtcgcgcgccaggtaccaggtcaaaggaa
cactctaccacgcaccacttgcgcaggaagaattacgaggacgattttttcgacctctcc
gacagggaccagaacatcgtcctgtag

DBGET integrated database retrieval system