KEGG   Plasmodium knowlesi: PKH_072670Help
Entry
PKH_072670        CDS       T01094                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pkn  Plasmodium knowlesi
Pathway
pkn00230  Purine metabolism
pkn01100  Metabolic pathways
Module
pkn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PKH_072670
Enzymes [BR:pkn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PKH_072670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 RsgA_GTPase AAA_33 AAA_22 AAA Rad17 ABC_tran RNA_helicase DUF913 Roc AAA_16 ATPase_2
Motif
Other DBs
NCBI-GeneID: 7320017
NCBI-ProteinID: XP_002258564
UniProt: B3L2W0
Position
7:1173279..1173869
Genome map
AA seq 196 aa AA seqDB search
MMRIPPLVVCGPSGVGKGTLIKRLLGEFPSLFRFSISCTTRKKREKEMDGVDYYFVDKED
FEQKIKEEQFLEYDNYANNFYGTLKSEYDIAAGENKICLLEMNINGVKQLKESKHIEDGI
YIFVKPPSIEILLKRLKNRNTENPEEIKKRMQELTREMDEADKVGFNYIIVNDDLARTYG
ELRKYLLGSYPQLGGA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgaataccaccgttggtagtatgcgggccctctggcgtggggaaggggacactg
ataaagaggctgttgggcgaatttcctagtctcttccgtttctccattagctgcactact
aggaagaaaagggaaaaggaaatggacggggtggactactactttgtagataaggaagat
ttcgagcagaagataaaggaagaacagttccttgaatatgataactacgcgaataacttt
tatggtaccctaaaaagcgagtacgatattgccgctggggaaaacaaaatctgccttctc
gaaatgaacatcaacggggttaagcaattaaaagaatccaaacacatagaggatggcatt
tatatttttgtaaaaccaccaagtattgaaattcttttgaagagactgaagaataggaat
acggagaatcctgaagaaattaaaaagcgcatgcaggagttgacacgcgagatggacgaa
gccgacaaggtgggctttaactatatcatcgttaatgatgatttggcgcgcacgtatggg
gagctgaggaagtatttactgggctcttacccgcagttagggggggcctaa

DBGET integrated database retrieval system