KEGG   Plasmodium knowlesi: PKH_072670Help
Entry
PKH_072670        CDS       T01094                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pkn  Plasmodium knowlesi
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PKH_072670
Enzymes [BR:pkn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PKH_072670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:1173279..1173869
Genome map
AA seq 196 aa AA seqDB search
MMRIPPLVVCGPSGVGKGTLIKRLLGEFPSLFRFSISCTTRKKREKEMDGVDYYFVDKED
FEQKIKEEQFLEYDNYANNFYGTLKSEYDIAAGENKICLLEMNINGVKQLKESKHIEDGI
YIFVKPPSIEILLKRLKNRNTENPEEIKKRMQELTREMDEADKVGFNYIIVNDDLARTYG
ELRKYLLGSYPQLGGA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgaataccaccgttggtagtatgcgggccctctggcgtggggaaggggacactg
ataaagaggctgttgggcgaatttcctagtctcttccgtttctccattagctgcactact
aggaagaaaagggaaaaggaaatggacggggtggactactactttgtagataaggaagat
ttcgagcagaagataaaggaagaacagttccttgaatatgataactacgcgaataacttt
tatggtaccctaaaaagcgagtacgatattgccgctggggaaaacaaaatctgccttctc
gaaatgaacatcaacggggttaagcaattaaaagaatccaaacacatagaggatggcatt
tatatttttgtaaaaccaccaagtattgaaattcttttgaagagactgaagaataggaat
acggagaatcctgaagaaattaaaaagcgcatgcaggagttgacacgcgagatggacgaa
gccgacaaggtgggctttaactatatcatcgttaatgatgatttggcgcgcacgtatggg
gagctgaggaagtatttactgggctcttacccgcagttagggggggcctaa

DBGET integrated database retrieval system