KEGG   Plasmodium knowlesi: PKH_073290Help
Entry
PKH_073290        CDS       T01094                                 

Definition
camp-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PKH_073290
Protein kinases [BR:pkn01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PKH_073290
Messenger RNA biogenesis [BR:pkn03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PKH_073290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:join(1423425..1423548,1423711..1423868,1424021..1424205,1424442..1424601,1424772..1425170)
Genome map
AA seq 341 aa AA seqDB search
MIQFLKNLHLHKKKDSASTKEPKRENKMKYEDFNFIRTLGTGSFGRVILARYKNEDFPPV
AIKRFEKSKIIKQKQVDHVFSERKILNYIKHPFCVNLYGSFKDESYLYLVLEFVIGGEFF
TFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPENLLLDKDGFIKMTDFGFAK
VVDTRTYTLCGTPEYIAPEILLNVGHGKAADWWTLGIFIYEMLVGCPPFYANEPLLIYQK
ILEGIIYFPKFLDTNCKHLMKKLLSHDLTKRYGNLKKGAQNVKEHPWFGNIDWVSLLHKN
VEVPYKPKYKNVFDTSNFERVQEDLTIADKITNENDPFFDW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattcagtttttgaaaaaccttcatctgcacaagaagaaggacagtgcaagtactaaa
gagccgaagagggagaataaaatgaaatatgaggatttcaacttcattcgaacacttggc
acaggctccttcggaagagtgattctggcgaggtacaagaatgaggatttccccccggtg
gctatcaagagatttgagaagagtaaaataatcaaacagaagcaagtagaccatgtcttt
tcggagaggaagattctgaactacatcaagcacccgttctgtgttaacttatatgggtcc
ttcaaggacgagtcgtacctataccttgtgttggagttcgtaattgggggagagtttttt
acctttctgcgaagaaacaagcgctttcctaacgacgtggggtgtttttacgcggcacag
atcgtgttgatatttgaatacctccaaagtttaaatatagtctacagagacctgaagcca
gagaacctactgctcgacaaggatgggttcataaaaatgaccgacttcggattcgcaaaa
gtcgtggacacgcgaacgtacaccctgtgcgggaccccggagtacattgcgccggaaatt
ctcctgaacgttggccatggcaaggcggccgattggtggaccttaggaatcttcatctat
gaaatgctggttggttgcccccctttctacgcaaacgagcccttgttgatttatcaaaaa
attcttgagggcatcatatacttcccgaaatttctggatacaaactgcaagcacctcatg
aagaaactattgtctcatgacttaacgaagagatatggaaatctaaagaagggggctcaa
aatgtgaaggagcatccatggtttgggaatatcgactgggttagcttgctccacaagaat
gtagaagtaccttataagccaaagtacaagaacgttttcgacacctcaaacttcgagagg
gtacaggaggacttgactattgcagataaaattacgaacgagaacgatcccttctttgat
tggtag

DBGET integrated database retrieval system