KEGG   Plasmodium knowlesi: PKH_082250Help
Entry
PKH_082250        CDS       T01094                                 

Definition
(RefSeq) Triosephophate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pkn  Plasmodium knowlesi
Pathway
pkn00010  Glycolysis / Gluconeogenesis
pkn00051  Fructose and mannose metabolism
pkn00562  Inositol phosphate metabolism
pkn01100  Metabolic pathways
pkn01110  Biosynthesis of secondary metabolites
pkn01130  Biosynthesis of antibiotics
pkn01200  Carbon metabolism
pkn01230  Biosynthesis of amino acids
Module
pkn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PKH_082250
   00051 Fructose and mannose metabolism
    PKH_082250
   00562 Inositol phosphate metabolism
    PKH_082250
Enzymes [BR:pkn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PKH_082250
Exosome [BR:pkn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PKH_082250
  Exosomal proteins of bladder cancer cells
   PKH_082250
  Exosomal proteins of melanoma cells
   PKH_082250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 7320405
NCBI-ProteinID: XP_002258869
UniProt: B3L421
Position
8:complement(join(1040744..1040857,1040972..1041066,1041306..1041426,1041644..1042450))
Genome map
AA seq 378 aa AA seqDB search
MRDLLLRALCIYWVGTECMGFSDCLSNDLSMHHLKSKEVRSFYLRSKPPLKGRKKQAQGI
SAYRINKLDSESENTNKVVENSSPIDNDVGAVANSQDSSQGSSLLDPSPKPRTSEARGKK
IIIGNWKCYLTKTEAYRLIDTFTKIKYSNNIDLVLSPNILFMPYLLEKIEENNSKIFACS
QDVSLASGLGAFTGETTATLIKEFGNKYTIIGHSERRRGFYKNEETLEQTAQKVYNAVQS
KLKVILCVGDDYKNENGLCTSSKTRKLLSLIKQAITKDDMQNIIIALEPSFAVGTGKSLA
VDVLNNCYWDIKRNVAEEVDKQTSDAVKILYGGSVTRRNMKDYMEKTPVDGFLIGKASLD
ETFIDIIKYVDQSCDSST
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagagatctactcttgcgtgctctatgcatctactgggtaggcacagaatgcatgggc
ttcagtgactgtctatcgaacgatttatccatgcaccacctgaaatctaaggaggtgcgt
tccttctatctccgctcaaaaccccccctaaaagggaggaagaagcaagcccaaggaatc
agtgcctacaggataaacaaattagattctgaaagtgaaaacacaaataaggtggtggaa
aattcctcccctattgacaacgacgtgggcgccgtggccaattcccaggatagttcgcag
ggtagttcgctgcttgatccgtcgcctaaaccgcggactagcgaagcgagggggaaaaaa
atcatcatcggaaactggaagtgctacctcacgaagacagaagcatacagacttatcgac
acgtttacaaaaataaaatactccaacaatatcgaccttgttttatctcctaacatattg
ttcatgccctatcttctggaaaaaattgaagaaaataattcgaagatctttgcctgctcc
caggacgtcagcttggcaagtggcttgggggccttcaccggagaaaccacagccacttta
ataaaagaatttgggaataagtacaccataattggacatagtgagaggcgtagagggttt
tataaaaatgaggagacacttgaacagacagcgcagaaggtatacaacgctgtacaatcg
aagctgaaagttatcttatgcgtcggggatgattataaaaatgagaacggtttatgcacg
tcatccaagacaagaaaattgctttcgctcatcaagcaggcaattactaaggacgacatg
cagaacattatcatagccctggagcccagcttcgccgtcggcaccggcaaaagcttggcg
gttgacgttttgaataactgctattgggacatcaaacgaaacgtagctgaagaggtggac
aagcaaacaagcgacgcagtgaaaatcctttacggtggatcggtgaccaggcgaaacatg
aaggactacatggaaaaaacacccgtcgatggattcctcataggaaaggcttccctggac
gaaacctttatcgacatcataaagtacgttgaccaatcatgcgattccagtacatag

DBGET integrated database retrieval system