KEGG   Plasmodium knowlesi: PKH_082250Help
Entry
PKH_082250        CDS       T01094                                 

Definition
Triosephophate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pkn  Plasmodium knowlesi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PKH_082250
   01230 Biosynthesis of amino acids
    PKH_082250
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PKH_082250
   00051 Fructose and mannose metabolism
    PKH_082250
   00562 Inositol phosphate metabolism
    PKH_082250
Enzymes [BR:pkn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PKH_082250
Exosome [BR:pkn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PKH_082250
  Exosomal proteins of bladder cancer cells
   PKH_082250
  Exosomal proteins of melanoma cells
   PKH_082250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
8:complement(join(1040744..1040857,1040972..1041066,1041306..1041426,1041644..1042450))
Genome map
AA seq 378 aa AA seqDB search
MRDLLLRALCIYWVGTECMGFSDCLSNDLSMHHLKSKEVRSFYLRSKPPLKGRKKQAQGI
SAYRINKLDSESENTNKVVENSSPIDNDVGAVANSQDSSQGSSLLDPSPKPRTSEARGKK
IIIGNWKCYLTKTEAYRLIDTFTKIKYSNNIDLVLSPNILFMPYLLEKIEENNSKIFACS
QDVSLASGLGAFTGETTATLIKEFGNKYTIIGHSERRRGFYKNEETLEQTAQKVYNAVQS
KLKVILCVGDDYKNENGLCTSSKTRKLLSLIKQAITKDDMQNIIIALEPSFAVGTGKSLA
VDVLNNCYWDIKRNVAEEVDKQTSDAVKILYGGSVTRRNMKDYMEKTPVDGFLIGKASLD
ETFIDIIKYVDQSCDSST
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagagatctactcttgcgtgctctatgcatctactgggtaggcacagaatgcatgggc
ttcagtgactgtctatcgaacgatttatccatgcaccacctgaaatctaaggaggtgcgt
tccttctatctccgctcaaaaccccccctaaaagggaggaagaagcaagcccaaggaatc
agtgcctacaggataaacaaattagattctgaaagtgaaaacacaaataaggtggtggaa
aattcctcccctattgacaacgacgtgggcgccgtggccaattcccaggatagttcgcag
ggtagttcgctgcttgatccgtcgcctaaaccgcggactagcgaagcgagggggaaaaaa
atcatcatcggaaactggaagtgctacctcacgaagacagaagcatacagacttatcgac
acgtttacaaaaataaaatactccaacaatatcgaccttgttttatctcctaacatattg
ttcatgccctatcttctggaaaaaattgaagaaaataattcgaagatctttgcctgctcc
caggacgtcagcttggcaagtggcttgggggccttcaccggagaaaccacagccacttta
ataaaagaatttgggaataagtacaccataattggacatagtgagaggcgtagagggttt
tataaaaatgaggagacacttgaacagacagcgcagaaggtatacaacgctgtacaatcg
aagctgaaagttatcttatgcgtcggggatgattataaaaatgagaacggtttatgcacg
tcatccaagacaagaaaattgctttcgctcatcaagcaggcaattactaaggacgacatg
cagaacattatcatagccctggagcccagcttcgccgtcggcaccggcaaaagcttggcg
gttgacgttttgaataactgctattgggacatcaaacgaaacgtagctgaagaggtggac
aagcaaacaagcgacgcagtgaaaatcctttacggtggatcggtgaccaggcgaaacatg
aaggactacatggaaaaaacacccgtcgatggattcctcataggaaaggcttccctggac
gaaacctttatcgacatcataaagtacgttgaccaatcatgcgattccagtacatag

DBGET integrated database retrieval system