KEGG   Plasmodium knowlesi: PKH_083070Help
Entry
PKH_083070        CDS       T01094                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pkn  Plasmodium knowlesi
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pkn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
8:complement(join(1460136..1461864,1462538..1462617))
Genome map
AA seq 602 aa AA seqDB search
MCGILAIFHSSIERHRLRRKALELSKKLRHRGPDWNGIVVEENEDGTTNVLAHERLAIVD
VLSGHQPLYDDAKEVCLTINGEIYNHMELRKLLPEDIIKNLTSQSDCAVIPNLYKKYTNK
MPSMLDGIFSGVISDHKKNTFFAFRDPIGVCPLYIGYASDGSIWFASEFKALKDSCVRYV
NFPPGHYYVNCKNKGEFVRYFNPNWWDLSAPIPNNKVDLEQIRVHLEKSVIKRLMGDVPF
GVLLSGGLDSSIVAAIISRYLKKIHGGERGVGGNQITNNDNNWKDSAADSWRLKSFSIGL
RNSPDLKAAREVANFLGSHHTEFHFTVEEGVDSLHDVIYHIETYDITTIRASTPMYILSR
LIKSSCVKMVLSGEGADEIFGGYLYFHKAPNREEFHRELQRKVHDLHMYDCLRANKSTMA
FGIEARVPFLDLDLLNLVMNIDPKEKMCSEGHIEKDILRRAFSGYLPDHILYRQKEQFSD
GVGYNWIDGLKEYAESKISDIQFSRAPFLFPYNTPKTKEAYLYRCIFSECFPEQCAQESV
PEGSSIACSSSKAIEWDASFKQNSDQSGRSVLGVHHSAKQFSDVKPVQMPDDESRALLSS
AT
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcttagccatttttcactcttccattgaaaggcaccgactgcgtaggaag
gccctggaactctcgaagaagctgaggcatcgaggccccgactggaacggaatcgtggtc
gaagagaatgaggacggaacgacaaacgtgctcgcacacgagcgcctggccatcgtcgac
gttctgtcgggtcatcagcctctgtacgacgacgccaaggaagtatgcctcacgataaat
ggagagatctacaatcacatggagctccgaaagctccttcctgaagacattataaaaaat
ctaactagtcaatctgactgtgcagttattccgaacttgtacaaaaagtatactaataag
atgccatccatgttagatggaattttttctggagttataagtgatcataagaagaacaca
ttttttgcgttcagagatcccataggagtttgtcctctctatataggatatgcatctgat
gggtctatctggtttgcctctgagttcaaggcgctaaaggatagctgcgttaggtacgtg
aacttccctcctgggcattactacgtcaactgcaaaaataaaggagagttcgttcgctat
tttaatcctaattggtgggatctaagtgctcccattccaaataataaagtcgacttggaa
cagattcgagttcatctggagaagagtgtgataaagaggctgatgggggatgtgcccttc
ggagtgttactctcagggggattggattcctccatcgtggctgctataatttccagatat
ttgaagaagatacacgggggggaaagaggcgtaggaggaaatcaaataacgaacaacgac
aacaattggaaggactctgccgccgattcctggcgattgaaaagcttctccatcgggctt
cgtaactcacccgacctgaaggccgcaagggaggtggcaaattttctggggagtcaccac
acagaatttcacttcaccgtggaggagggagtggattctctgcacgatgtgatctatcac
atagagacatacgacatcacgacgattcgtgcatctaccccaatgtacattctttcaaga
ttaataaaaagtagttgcgtcaaaatggttctaagtggagaaggtgcagacgaaatattt
ggagggtatctttacttccacaaggctcctaaccgagaagagtttcaccgcgagttacaa
aggaaggtgcatgacttacacatgtacgattgcttgagggcaaataagtctaccatggca
ttcgggatcgaagcacgcgttcctttccttgatctagatctcctaaatctagttatgaat
attgatcccaaagaaaaaatgtgttcagaggggcatatagagaaggacattttaaggcgt
gctttctctggctatttgcctgatcatattttatacagacagaaggaacaattttctgat
ggagttggatacaactggattgatggtttgaaggaatatgccgagagtaaaatttccgac
atacaattttcacgtgcaccctttttatttccatataacactcccaagacaaaggaggcc
tacttgtacagatgcattttctctgaatgctttccggaacagtgtgcacaggaatcggta
ccggagggatcctccatcgcttgctcgtcaagcaaggcgatcgaatgggatgcatcgttt
aagcaaaactcagatcagtcaggtaggtccgtgctgggcgtacaccacagcgcgaagcaa
ttctccgatgtgaagcctgtgcagatgcccgacgatgagagcagggcgcttctatcaagc
gcaacctaa

DBGET integrated database retrieval system