KEGG   Plasmodium knowlesi: PKH_091110Help
Entry
PKH_091110        CDS       T01094                                 

Definition
mitogen-activated protein kinase 2
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PKH_091110
Protein kinases [BR:pkn01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PKH_091110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(476439..478004)
Genome map
AA seq 521 aa AA seqDB search
MLKKKKEFSNTDGEEKNAKKKNNLTVKSASLKKKGNTSTEATDGEEKAAKSDHVKGKTQG
GGVKQCTFVEGKKNEKGKEQKVTSSDVAASKVGGEKGGDEKINIKEAIIKNVKVPDNYEI
KHLIGRGSYGYVYLAYDRSTNKNVAIKKVNRMFEDLIDCKRILREITILNRLKSNYIIGL
HDLVIPEDLLKFDELYIVLEIADSDLKKLFKTPIYLTEEHVKTILYNLLLGEKYIHESGI
IHRDLKPANCLLNQDCSVKICDFGLARTINCEKDIHIVQDLEEKEENEEPGPHNKNLKKQ
LTSHVVTRWYRAPELILLQENYTNSIDIWSTGCIFAELLNMLESHVNNPTNRFPLFPGSS
CFPLSPDHNSKKVHEKSNRDQLNIIFNVIGTPSEDDLKSIKKDDVIRYIKLFPPREGIDF
RKKFPSISEDGINLLQSMLKFNAKNRITIDNALSHPYLKDVRKINLEKFTSSKIILPFDD
WMMLSETQLRYIFLKEIQSFHPELVIPPKLSVHEGTFYNEV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagaagaaaaaggagttttccaacacagatggagaagaaaaaaatgccaagaaa
aagaataacttaactgtgaaatcagcatccttgaagaaaaagggtaacaccagtacggaa
gccacagacggggaggagaaggcggcaaaaagcgaccatgtgaaggggaagacacagggg
ggaggagttaagcagtgcaccttcgtggaggggaagaaaaacgagaagggaaaagagcaa
aaagttacctcatcagatgttgccgcttcaaaagttgggggagaaaaaggaggggacgaa
aagatcaacataaaggaggcaattataaaaaacgtcaaggtgccagacaactacgaaatc
aagcatttgatagggagagggtcatacggatacgtctacctagcatacgacagaagcacg
aataaaaatgtcgcaataaagaaggtgaatagaatgttcgaagacttgattgattgtaag
agaattttgagggaaataactattttgaatagactaaaaagtaactatataattgggttg
cacgatttagtaatccccgaagatttgctaaagtttgacgagctctacatcgtcctggaa
atagcagattccgatctgaaaaaactttttaaaacgccaatttacctgaccgaagaacat
gtaaagacaatcctttataatttactcctaggagaaaagtacatccatgagtcaggtatt
atacacagagatttaaagccagccaactgtctcctcaaccaagactgctccgttaaaatt
tgcgactttggattagccaggaccatcaactgtgaaaaggatattcatattgtgcaggat
ttagaagagaaggaggaaaatgaagaaccaggtccacacaataaaaatctgaaaaaacaa
ctaactagtcatgtggtgaccagatggtatagagcaccagaacttattttgctacaagaa
aattataccaattcaattgacatttggtctacgggttgcatattcgctgaattattaaac
atgttagagagtcatgtgaataaccctacaaatagattcccattatttcctggctcctct
tgttttcctctttctcctgatcataactccaaaaaggtacatgaaaaaagcaacagagat
cagcttaacataatttttaacgttataggaaccccctcggaagatgatcttaagagcatc
aagaaggatgatgtcataaggtatattaaactctttccacccagggaaggtatcgacttt
agaaaaaaattcccctccatttcggaggatggaattaacttactacaatctatgcttaaa
tttaacgctaaaaataggatcacaatagacaacgctctcagtcacccctatctgaaggac
gttagaaaaataaatttggagaaattcacttctagtaagattattctaccattcgatgat
tggatgatgctctctgagacccaactccggtacatttttttgaaggaaatccagtccttt
catccagagttggtaatcccacctaagttgtccgttcatgagggcaccttctacaacgaa
gtttaa

DBGET integrated database retrieval system