KEGG   Plasmodium knowlesi: PKH_091450Help
Entry
PKH_091450        CDS       T01094                                 

Definition
ubiquitin C-terminal hydrolase, family 1
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PKH_091450
Peptidases [BR:pkn01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PKH_091450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
9:630296..631651
Genome map
AA seq 451 aa AA seqDB search
MQRSSNDSLSEWCLIESNPCIFNDMLSRMGAKNLSVEDVYDLDFFDDYICNRDVVTVENV
LSVDEYRSEKEKKVKEEWAMPPMEEGNAVEGTTGEMSSHKEGAQKGLYSSTVGTDVKYNK
LIKNENNIYGIIFLFNIDKNYNRNKFVEHSVPDDLFFAKQVIPNACATQAILSIVLNKEV
ELNEEIKNIKSFSNSFDSSMKGLTLSNCNFLRNIHNSYKPPIYIEKENLHDEKGKMNDSF
HFVSYIQFGGSVYMLDGLQEGPVLVGQMNGANENRSWIDLAKEHIKKEITDICNASAKGE
GGEGGDGRFNILAVVKDKEHIINEFCNIHRIVKKRVNIKLSTLGKEDVDLNDNINEEDFN
YPSIPTIEELPDDISELLLIAQKSTGEINFLHSLLQEQIQLKLSWNKELTFKFFNFYPFV
MSSLNLMAKHNILKEAYEKQMQKQKHSRGSA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcagagaagcagtaacgacagcttgagtgaatggtgcctaatcgagagcaacccatgc
attttcaatgatatgttaagtcggatgggggcgaagaacctctccgtggaagatgtgtac
gatctagattttttcgatgattacatttgtaatagggatgtggtaactgtagaaaatgtt
ctgagtgtggatgagtatcgaagtgagaaggagaagaaggtgaaggaggagtgggccatg
cctcccatggaggagggcaacgcggttgaaggtaccactggggaaatgtcttctcataag
gaaggcgcacaaaagggattgtacagcagtaccgtagggacagatgtaaaatacaacaaa
ctaataaaaaacgagaacaatatttatgggataatttttctttttaacatcgataagaat
tacaataggaataaatttgtcgagcacagtgtaccggatgatcttttttttgcaaaacag
gtgattccaaatgcatgtgccacacaagccatcctatccattgtccttaacaaggaggtg
gagctgaatgaagaaataaaaaatataaaatcctttagcaacagctttgatagctccatg
aagggactcactctttcgaactgtaacttccttcgtaacatacacaattcgtacaaacct
cccatatatatagagaaggagaacctgcacgatgagaagggaaaaatgaatgattctttc
cacttcgtttcgtacatacagtttggtggaagtgtgtacatgctcgatgggctacaggag
gggcccgttttagttggacagatgaatggcgcaaacgagaatcgtagttggattgatctc
gccaaagaacacataaagaaagaaatcaccgacatatgcaacgctagtgctaagggagaa
ggtggtgaaggaggagatggacgattcaacattctggctgtagtaaaagacaaggaacat
attattaatgaattttgtaacatacatagaattgtaaaaaagagagtaaacattaagtta
agtaccttgggaaaggaagatgtcgatttaaacgacaatataaatgaagaagattttaac
taccctagcataccaaccatagaggaactcccagatgatatttcagaactacttcttatt
gctcaaaaatcaaccggagaaattaacttcctccactcacttttgcaggaacaaatacag
ttgaaactatcctggaacaaggaactcactttcaaatttttcaatttctacccttttgtc
atgtcctccttgaatctcatggcgaagcataacattttgaaggaggcctacgagaaacag
atgcagaaacagaagcatagtcggggctccgcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system