KEGG   Plasmodium knowlesi: PKH_091750Help
Entry
PKH_091750        CDS       T01094                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pkn  Plasmodium knowlesi
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PKH_091750
   01230 Biosynthesis of amino acids
    PKH_091750
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PKH_091750
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PKH_091750
Enzymes [BR:pkn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PKH_091750
Exosome [BR:pkn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PKH_091750
  Exosomal proteins of melanoma cells
   PKH_091750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
9:join(739976..740009,740271..740352,740545..741181)
Genome map
AA seq 250 aa AA seqDB search
MTTYTLVLLRHGESTWNKENKFTGWTDVPLSEQGEKEAISAGNYLKEKNFRFDVVYTSVL
KRAITTTWNVLKTGELLHVPVIKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYD
IPPPKLDKEDSRWPGHNVVYKNIPKDVLPFTECLKDTVERVLPLWFDHIAPDILANKKVL
VSAHGNSLRALVKHLDKLTEADVLELNIPTGVPLVYELDENLKPIKHYYLMDSEELKKKM
DEVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatacacgttggttctactaaggcatggtgaaagcacttggaacaaggagaac
aaattcacgggatggacggatgtacccctcagtgaacaaggagaaaaggaagccatatcc
gccggaaactacctaaaggagaagaatttccgcttcgacgtcgtgtacacgtcggtgttg
aagagagccatcaccacaacctggaatgtgctgaagacaggagaactgctacacgtacct
gttattaaaacatggagactaaatgaaaggcattatggatctctacaaggattgaacaaa
tctgaaacggcaaaaaaatacggagaggaacaagtgaaaatttggagaagatcctatgat
atccctcctcccaagttggataaagaagatagtagatggccaggacataatgtcgtttac
aagaatatcccaaaggatgtgctaccctttacggagtgtttgaaagacaccgtcgaaaga
gttttacccctctggttcgatcacatagcacctgatatattggcaaataaaaaggttctt
gtatcagcacatggaaatagcttgagagcgttagtcaaacatttagataaattaaccgaa
gcagatgttttggagctcaacattccaacgggtgttcccctagtgtatgagttggatgaa
aatctcaagccaattaaacactactacctgatggacagtgaggaactcaagaaaaaaatg
gacgaagtagcaaatcagggaaaggccaaatga

DBGET integrated database retrieval system