KEGG   Plasmodium knowlesi: PKH_093200Help
Entry
PKH_093200        CDS       T01094                                 

Definition
Protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pkn  Plasmodium knowlesi
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PKH_093200
Enzymes [BR:pkn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PKH_093200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(1408652..1409926)
Genome map
AA seq 424 aa AA seqDB search
MKPVVPLIFSLMLLAGLCPRQASGLYSNVKEIKTVENSKEFEELLSAKKVCLVEFYATWC
RASRGFANDFTSIAKTIKDDITILAVKNEDIINQYKIETYPSIYVFFSNGNKKDVEKFDG
NYKIKEVISFVYDSIKKHRLKELNIDLDDVNKSSYKKKGKKKNDGKVIILNDGNFDNSVL
QDDENVWFVFFYAPWCGHSKPIHPMFDQLAKKVSHLKNARIAKIDATVEQRSAQTYQIRH
YPSFRLFPSGKKKSHSAIEYNDSRTVEDMYQFFLKYYSEKKEVIQLTSQQVFDEFCEKDV
CLLAILPNKEDTELSYFKSYVQILTNVIKDVSTLPVTLLWTQAGDQLDLVQKLNLTFGFP
TVIAISFSKNVYSILKGNYSEQSIKNFITQMMMGKSSVDNLVPFTVKTVPKFTFTNEQEA
NSEL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgtggtacccctaattttctcgctgatgctcctggcgggcctatgccccagg
caggcctcgggtttgtactcaaatgtgaaggaaatcaaaacagtggagaattccaaagaa
tttgaggagttgctaagtgccaaaaaagtctgtttggttgaattttacgcaacgtggtgc
agagcctccagagggtttgcgaacgactttaccagcatagccaagacgataaaagacgac
ataacaattttggccgtaaaaaatgaagatataattaaccagtacaaaattgaaacttac
ccaagtatatatgttttcttctcaaacggtaataaaaaagatgtggagaaatttgatgga
aattacaaaataaaagaagtgatttcctttgtatatgatagtataaaaaagcaccgtttg
aaagagctaaatatcgacctagatgatgtaaataaaagttcttataaaaaaaaaggaaag
aaaaaaaacgatggaaaagtaattatactaaatgatggcaattttgataacagtgtgtta
caggatgatgaaaacgtctggtttgtctttttctacgctccatggtgtggacacagtaaa
ccgatacaccccatgttcgaccaactagcaaaaaaagtatctcatttgaagaacgcacga
attgccaaaatagacgctacagtggaacaacgatcagcgcaaacttatcaaataaggcat
tatccatcttttaggttattcccatcaggaaagaaaaaatcacatagtgctatagaatat
aacgactctagaacggtggaggatatgtatcaattctttttaaaatactattcagaaaag
aaggaagtaattcagttaacttctcaacaagtgtttgatgaattttgcgaaaaagatgta
tgtctcttagctattttaccaaacaaagaagacactgaactgagttatttcaaatcctat
gtgcagatacttaccaatgttattaaagacgttagtacgttaccagtcactttgttgtgg
actcaagcaggagatcaactagaccttgtgcagaagttaaaccttacattcggtttcccc
actgttattgccattagcttttcgaaaaatgtctattccattttgaaggggaattattct
gagcagtccatcaaaaatttcatcacacaaatgatgatgggcaaatcttctgtcgacaat
ttggttccctttacggtgaaaacggtacccaaatttacttttaccaacgagcaagaagcc
aactcagagttgtaa

DBGET integrated database retrieval system