KEGG   Plasmodium knowlesi: PKH_100480Help
Entry
PKH_100480        CDS       T01094                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
pkn  Plasmodium knowlesi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
10:join(258766..258866,259430..261167)
Genome map
AA seq 612 aa AA seqDB search
MTIVNVTVKWKSHVYNDLQLDTSKPILTFKEILWTLTNVPPEKQKLMYKGLIKDDTDLST
LNIKNNDKIMLVGSAETLVEGPSHVVFVEDLSKEDKEKIHAKENILFEDQGIVNLGNTCY
FNAVLQFLTSFDDLGSFLCNIKRKEKYLLKSTNDILFDSYIHFSQTFGKSPEPYVPLELL
KSFRDVFPKFRTVNLRTKQFAQQDAEECMNAILTSLNDHTECKISDKLFSFKVISKIRCI
EDDATGGEKPTKENASGDNAPSENTPNTLQGEEIETTEEFHNKLICYMGTHTTPVNHMHE
GIRLSLIEKIQKQRSEDSKEDALFEKKSEMNSLPPYLIVHFLRFESKKISESNNAISVVT
AKICRKVSFPETFDIYDFCTDELKTQLKVARNIVMKRKEADLNARGGAEGVGGNTATSPQ
KKEGVNDNSVNERANDSTNGVTNGVTNGVTNGATNGATDGATDGITNAVTNAVTNAVTDA
VTSDEPTAANHVDDKGSRPTGDLTEIPTGEYELISIITHKGRNEESGHYIAWKKMRSSIG
TDSNTYKEELTGNKKKGKDSLWYKMDDDKVSTHKFSSLDLCGGCSDFNIAILLLYKRKTL
LCTQEELNSHGN
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgttaatgtgacagtaaaatggaagagtcatgtgtacaacgatttacaactc
gacacgtctaagcccatcttgacattcaaggagattctctggactctcaccaacgttcct
ccagaaaaacaaaaactgatgtataaaggcctcatcaaagatgatacagatctatccaca
ttaaacataaaaaataatgacaaaattatgttagtaggttcagcggagactttagtagaa
gggccatcccatgtagtttttgtggaggatctctccaaagaagataaagagaaaatacac
gcaaaagaaaatatcctttttgaagatcaaggaattgtgaatttaggaaacacctgctac
ttcaacgcagtattgcaattcttaacatcctttgacgatttaggatctttcctttgcaac
ataaaaagaaaggaaaagtatttattgaaatccacaaacgatattttattcgattcatat
attcacttttctcaaacgtttggaaaatctcccgaaccatatgtccctctagaattgttg
aaatcctttagggatgtgtttccaaaatttagaactgtaaatttaaggacgaaacaattt
gcacaacaggacgcagaagaatgcatgaacgccattctcacgtcattgaatgatcatacc
gagtgtaaaattagtgataagttattttcgtttaaggtgatcagtaaaattagatgcata
gaggacgatgctacagggggagagaaaccaactaaggaaaacgcttcaggggataacgca
ccaagtgaaaacacacccaatacactccaaggtgaagaaatagaaacaacagaagagttc
cacaataaactaatatgttacatgggaacacacacaacccctgtgaaccacatgcatgaa
ggaatacgactatccttgattgaaaaaatccaaaagcagcgatctgaggatagtaaggaa
gatgccttgtttgaaaaaaaatcagaaatgaactccctccctccatatctaattgttcac
tttttacgttttgaatcaaagaagatctcagagtcgaataatgccatttccgtcgttact
gccaagatatgcagaaaggtcagtttcccagaaacgtttgatatttatgatttctgcaca
gatgaactaaagactcaattgaaagtagctaggaatattgtgatgaagaggaaggaagcg
gacttgaacgcccgcgggggtgccgaaggtgtcggaggaaacactgccacaagtccgcag
aaaaaggagggcgtgaacgataatagtgtcaatgagagggcaaacgacagcacgaacggt
gttacgaacggtgttacgaacggtgttacgaacggcgctacgaacggcgctacggacggc
gctacggacggcattacaaacgctgttacgaatgctgttacaaacgctgttacagacgcc
gtgacgagcgatgagccaacagctgcgaaccatgtggatgataagggtagcagaccaacg
ggggatttgacggaaatccccacgggggaatatgaattaatttcaataatcacacacaag
gggagaaatgaagaaagtggtcattacattgcttggaagaaaatgaggagctccataggc
acagatagcaatacgtacaaagaagaactaacaggtaataaaaaaaaaggaaaggattcc
ttgtggtataagatggatgatgataaggtaagtactcataaattttcttcccttgattta
tgtggagggtgtagtgattttaacatagctatattgcttttgtataaacgaaagaccctg
ttatgcacacaggaagagttgaactcccatgggaactga

DBGET integrated database retrieval system