KEGG   Plasmodium knowlesi: PKH_101510Help
Entry
PKH_101510        CDS       T01094                                 

Definition
eukaryotictranslation initiation factor 3 subunit
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pkn  Plasmodium knowlesi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PKH_101510
Translation factors [BR:pkn03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PKH_101510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(724046..726196)
Genome map
AA seq 716 aa AA seqDB search
MVKVSESELSDKELEEFLSDDSDEGNEELLNKKYTEKEALITLETKFPKIVTILGIPKVE
EEKHSRLAEVLKKLFIKHLNAKISDSSLLNIKIYMPVDDDKKTKGICFVTFNDSFQANEA
VKILNKLKLDAKHVLTASKMDDIENIISRDEHVMPINVVGFTREKIRWWLYDERCREQFI
VRYDSHFEVHWFDPLEKEPQLIYTTYKKSAPFSSVQWSNQGSYLVSFHNPGIALWGGDNF
EKLIRLQHKSVKEISFSPNENYVLTWDGTPASLRNEKSICIWRVITGKLLRSFITPEYSA
RDKSYHYFLWSPDDKYIACMGKQKEVYVYELPSMLLMEDHEKKRTPLKYTFVKEFDWSPV
DNIMSIWIPGTKTTPGTLILVDIPSRKELVSRKIYDVVHASIHWQSKGDYLCLKTTIEKK
ISKKSKKEFTQLEIFRIREKNIPVDNVQIDGIKTKQFHWEESSSNRFALIVRDEATSRQQ
IRFYKIENKGTARNTKWISTFDINSQMNFMRWSPQGSYFILASLGSEGLLYFCLLNSNDE
VEVIHKDEHLLANSVSWSNCGRYLVTSVSCMANAGGSNYREENSETGFFIWSFQGRCLMT
IKKPSFFQFFFRPHPKSLFSDKQKVDIKNNLKDYSKKFDVMDEKVRQAKRNQLITDRKTV
EESFNEKIEKVTQLFHSFKEYEEFKKNWEQFESQFEWEEKTVVIEHVLSVKQEIFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggtctcggagagcgaactgagcgacaaggagttggaggaattcctgtcggac
gacagcgacgagggaaatgaggaactgttaaataaaaagtatacggagaaagaagcactg
attacgctggaaaccaaatttcccaaaatagttacgatattaggtattccaaaggtagag
gaagagaagcatagcagattggcggaggtgttgaagaaattatttataaaacatttgaat
gccaaaataagtgactcctccttattgaacataaaaatatacatgcctgtagatgatgac
aagaaaaccaaagggatctgcttcgtaacctttaatgacagtttccaggcaaacgaagca
gtgaagattctgaacaagttgaagctggatgcaaaacacgtgttaaccgcttcgaaaatg
gatgatatagaaaatattataagtagagatgaacacgttatgccaataaatgtcgttggt
tttacgagagaaaaaatcagatggtggttatatgatgagaggtgtagagaacagttcatt
gtccggtacgattctcactttgaagttcactggtttgatcccctggaaaaagaaccacaa
ctcatttacactacttataagaaaagtgcacctttctccagtgtgcagtggagtaaccaa
ggatcctatttagttagttttcacaaccctggtatagctctctgggggggagacaacttc
gaaaaattaattcgattgcagcataaaagtgtaaaggagattagtttttctcccaatgaa
aattatgttctcacatgggatggtacccctgcgtctttgagaaatgaaaaatccatatgt
atttggagagtaataacaggaaaattgttgcgttcgtttattacgccagaatatagcgcc
agggataagagctaccattactttttgtggagtccagatgataaatacattgcttgtatg
ggaaagcagaaggaggtgtatgtgtatgagctgccaagtatgttgttgatggaagaccac
gaaaagaagaggactcctcttaagtacacttttgtgaaggaattcgattggtctcctgtt
gataacattatgtccatatggattccagggacgaaaactaccccaggaacattaatcctg
gtagatattccctctaggaaggaacttgtgtcgagaaaaatatatgatgtggtgcatgca
tctatacattggcaaagtaagggagattacttgtgtctgaaaactaccatcgaaaaaaag
attagtaagaagagcaaaaaggaattcacccaattagaaattttccgcatcagagaaaag
aacatccccgtggataatgttcaaatagatggaatcaaaacgaagcaattccattgggaa
gaatccagtagcaatagattcgctttaattgttagagatgaagccactagtagacaacaa
attaggttttacaaaattgagaacaagggcacagctagaaatactaaatggattagcacc
tttgatattaacagccagatgaactttatgcgttggtcaccacagggatcctacttcatt
ttagcttcattaggatcagaaggtcttctctacttctgccttctcaattccaatgatgaa
gtggaagtgatacataaagatgaacacctcctggcgaattccgtttcgtggagcaactgt
ggaaggtatctagtcacatcagtctcttgcatggcaaacgcaggtggctccaactatagg
gaagaaaatagcgaaacgggatttttcatatggtcttttcaaggcaggtgcttaatgacc
attaagaagccttccttctttcagtttttctttagaccacaccccaaatctctgttcagt
gacaagcaaaaagtcgacataaaaaataacttaaaggactattccaaaaagttcgatgtt
atggatgagaaggttagacaagccaaacgaaatcaactcataactgaccgaaaaactgtg
gaagagtcatttaacgagaaaatagagaaagtcactcaacttttccactccttcaaggag
tatgaagaattcaagaaaaattgggagcagtttgagagccaattcgaatgggaggagaaa
accgtcgtcattgaacatgtcctctcagtcaaacaggaaatatttgcataa

DBGET integrated database retrieval system