KEGG   Plasmodium knowlesi: PKH_101610Help
Entry
PKH_101610        CDS       T01094                                 

Definition
Ubiquitin carboxyl-terminal hydrolase 2
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PKH_101610
Peptidases [BR:pkn01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PKH_101610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(join(769863..773288,773611..774016,774164..774288))
Genome map
AA seq 1318 aa AA seqDB search
MDSTVTSNSPSKSLTLDKIQILNLFKLFDNLPFDPKNENETWYIVNKEFIDSLKSYEEGK
ASRYQTLIDNRIFVEDASNVTTRTRLLKDYENGNGVNFLLYPEKAIDVLEKHFHFNLKIP
RAVYPYKVPKREKVIYKVDIQPLKIVVYSKNPNDFSSPSKMKIVVLRNDTVEDVLREIVT
DFDPASFKKNLFYAEEMSGKKEYNWERLYLHDSTEYPLNNKIHEYDIDDRTCFLITNERA
DIKCLTNESDYAYTRREASFRRSEKEEDCMRGYSSGRTGGYASTTHTLGYTQENMDKQIS
YIFEHGGDRGLINLGNTCFLNSSLQCLAKIKKFSNYFLSGTFWNHINYSNPVGQNGRLAK
AYYETLLELWKINKRSEPYAPKALKLAISEKRDEFYGYQQHDSQELLAFLLDGLHEDLNL
IQKKPYYEEKLQGGLDKLDIDVAEASWNRHKEINNSIIVDLFQGQYRSRLQCPQCKKVSI
AFDPFMYLSIPLPPKKNHRIWFHVILNRDVPIGMRFSCSFSGSQEVLKLKIFLLTIIKNL
KVKRKNILLHNKCIIKNSKETVHHEGRNSNHANGPMPSSSGSSCSGGTADATNTSAFNFH
QKYLDEKNEFYEDNEDNCTNADIANYVRAIKNKNKITNTLKEQDICILHESICAMCNIQS
IEELEINNLSFLFTKFKNLACNQFFQVLNNTDFVTEPHTRNGKGISHIFVFILPKLYAHL
IDKNMDVKVPDESLEVLTNSTVTTNNTSLRDEEMNLKNETNHTNNNNNSNNSSNNNGTSE
KKAFKEKSNPSSKILKKRKGLLSSPNNNGSPIRKGEKIYPPGAEEDEDDEVTPMTSVPGE
LNTNSHANGNVNGSTPEAYDEAMEESNDLNMQDSSSEMPLYNSNGIRQSRYNCQQHISYN
ELLRDRIISTPDVYNLHDKYFSLLIVPLCKDEQLFYKMKNNDLPLLLNIPFNFTLNDLYS
KVENAYRKEPLGNSAHMEFIHNSNDQNNQPHDKNPYGEVYTHNGNVKSGGDEESAKKDSI
SSTDVTNKTITNEYDRVLEEKGNPNGVHMEENGASRFTLYLSCYNLKEEWTPKDNLGFEL
KRDETYLSDYIKNSEEKRLIIIHLNSVEIDYELSLDIKTMTFIDLEERYGIDTCLKLFSE
EEHLDENNTWYCGNCKLHVQAYKKLDLFRMPIILILHLKRFNNTNRWLRTKIDSYVYYPH
KENEYLDMAPYILEDGLKHMIKMDPTYSPLYELIGVNCHTGGLCGGHYFAYVKLNGQWYN
FNDTFVTTIEESQVNTKDAYLLFYQLHTHKNETFTGVADQRNLAEEEAIRMANASYYN
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atggattctacagtcacttcgaattcgcctagcaaaagcttaactcttgataagatccaa
attttgaatttgtttaaactgtttgataatttgcccttcgatccaaagaacgaaaatgaa
acatggtacatcgtgaacaaagaattcatagacagcctgaagagctacgaagaagggaag
gcgagtcgataccaaactctgatcgacaacagaatatttgtggaggatgccagtaatgtc
accacgaggaccagacttctcaaggattacgaaaatggcaacggagttaatttcctccta
tacccagagaaggccatagatgtgttggaaaagcattttcactttaacttaaaaatacct
agggctgtttacccctataaggttccgaagagggagaaggtaatttataaggttgacatt
cagcccctgaaaattgtggtgtactcgaagaacccgaacgacttcagcagcccgtccaag
atgaagatcgtcgtcctgcgcaacgacacggtggaggatgtcctaagggagatcgtcact
gacttcgaccccgcgagcttcaagaagaacctattctacgcagaggaaatgagcggaaag
aaggagtacaattgggagcgcctgtatctgcacgattcgacagagtaccccttgaacaac
aagattcacgaatatgatatcgatgacagaacctgtttcttaataacaaatgagcgagcg
gatataaaatgtctgacaaatgagagcgactatgcctacacgaggcgggaggcgagtttt
aggaggtcagagaaggaggaagattgtatgaggggctattcgagtggacgcaccggaggg
tatgctagtactacccacacccttggatatacacaagaaaacatggataaacaaataagc
tatatatttgaacatgggggtgatcgaggattgatcaatttaggaaatacgtgcttcttg
aattcctctctgcagtgtctagcgaaaataaaaaaattttctaactatttcctaagtgga
accttttggaatcacataaactactccaacccagtaggtcaaaatggacgactagcgaaa
gcttattacgaaacattgctggaactttggaaaataaataagagaagcgaaccgtacgca
ccaaaggcattaaaattagctataagtgaaaagagggatgagttttacgggtaccaacaa
cacgattcacaagaattgttagccttccttttagatggactccatgaagatttgaaccta
atacaaaagaagccctattacgaagagaaattacaaggaggattggacaaattagatatt
gatgtagcagaagcatcctggaatagacacaaagaaattaacaactccattatagtggac
ctgttccaaggacagtacagatcgcgtttacaatgcccccaatgtaagaaagttagcata
gccttcgatccgtttatgtatttatccatccccttacctcctaaaaagaaccatcgtatt
tggttccacgttatcctaaacagggatgtaccaataggcatgagattctcctgctctttc
agtggttcacaggaagtactaaaattgaaaattttccttctcaccataataaaaaattta
aaagtgaaaagaaaaaatattctacttcataataagtgtataataaaaaatagcaaggag
actgtccatcatgagggcagaaatagcaatcatgccaatggacctatgcccagtagcagt
ggtagcagttgtagtggtgggacggcagatgccactaacactagtgcctttaattttcac
caaaaatatttagatgaaaaaaatgaattctacgaagataatgaagataattgcaccaat
gccgatattgccaattacgtgagggctataaaaaataaaaataaaataacaaacacattg
aaggaacaagatatctgcatcctccatgaaagcatctgtgccatgtgtaacatacagtct
attgaagagctagaaattaataatttgagtttcctttttacaaagtttaaaaacctggct
tgcaatcaattttttcaagtcttaaataacacagattttgtcaccgagccgcatactaga
aatggaaagggcattagccacatttttgttttcatcttgccaaaattatatgcccacctg
attgataagaacatggatgtgaaggtgcctgatgagagtttggaagtactcaccaactcc
accgtcactacgaacaataccagtctcagggatgaagagatgaacctaaagaacgaaaca
aatcacaccaacaacaataataatagtaataatagtagtaataataatggtacctccgag
aaaaaggccttcaaggagaagagcaatccttctagcaagatacttaaaaagagaaaaggt
cttctcagctcccccaacaataatggtagccccattcggaagggagagaaaatttaccct
cccggagcggaggaggacgaagacgacgaggtcactcccatgacatcagttccaggggaa
ttaaatacaaattctcacgcaaatggaaatgtcaatgggagcacaccagaggcttacgac
gaagccatggaagagtcaaacgatttaaacatgcaggacagttcttcagagatgcctcta
tataattccaatggaatcaggcagagcagatataactgtcagcagcacatctcctacaat
gaacttcttagagatcgaattatttctacaccagatgtgtacaacctgcacgacaagtac
ttctccctccttatagtacccctttgcaaggatgagcaacttttctacaaaatgaaaaat
aatgatttgccccttctgctaaatatcccttttaattttacactgaatgacctgtacagc
aaggtggaaaatgcctacaggaaggagcccttgggaaatagtgcacacatggaatttatc
cacaattccaatgatcagaataatcaaccacatgacaagaatccctatggagaagtgtat
acacataacgggaatgtaaaaagcggaggagatgaagaaagtgcaaagaaggatagcata
tccagtaccgacgttacaaataagaccatcacaaatgagtacgatcgggtgttggaggaa
aagggaaacccaaatggggttcatatggaggaaaatggcgccagcagattcactctatat
ctttcttgctataatctgaaggaggaatggacgccaaaagataacctgggattcgaactc
aaaagagacgaaacctacctttcagattacataaaaaattctgaagagaagagactgata
attatacaccttaacagtgttgaaatagattatgagttgtccttggacataaaaacgatg
acattcatagatttggaggaacgctatgggattgatacatgtttgaagctgttttcggag
gaggaacacctggatgagaataacacttggtactgtggtaactgtaagctccacgtacaa
gcctacaagaagctcgacctattccgaatgccaatcatccttattttacacttaaaaaga
tttaacaacacgaataggtggctaaggacaaagattgattcctatgtttactaccctcac
aaagaaaatgaatacttagatatggccccgtacattttggaggatggtttaaagcacatg
ataaaaatggacccgacttattctcctttatatgagttaattggagttaattgccacacg
ggtggtctctgtggggggcactacttcgcctatgtcaaactcaacggtcagtggtacaac
ttcaatgataccttcgtcacgaccattgaggagtcgcaggtcaacacaaaagatgcatac
ctgctcttttatcagctgcatactcacaagaacgagactttcacgggtgtggctgatcag
aggaacttggccgaagaggaggctattcgcatggccaacgccagctattacaattag

DBGET integrated database retrieval system