KEGG   Plasmodium knowlesi: PKH_102180Help
Entry
PKH_102180        CDS       T01094                                 

Definition
stearoyl-CoA desaturase (acyl-CoA desaturase,faty acid desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pkn  Plasmodium knowlesi
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pkn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pkn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
10:complement(join(1022832..1024592,1024723..1025826))
Genome map
AA seq 954 aa AA seqDB search
MSYKAKNAGGNFSPVGEKMWEALSKRYLDIEHVGIIYITYVVFLASCYIFRKCFSNKFIH
FVNVFKGLLVTLISLVSLKYVDLNITLGINLLHVYNITQLCTFLESLWTNKKKTNEKSTS
QENRVVHKYEISKENENEYRNEYELIGDTSKHLEQLAKKILKNEKSIKENEGILKEKEII
EEIEKKEKEEEEYMKKKNTHDSQKKKDRSASNSIWIYFFFSQTFYIFFYFFFWKYIHNIM
IIKVYLTLQLSKSLISLASNFYHNNTNINLFKRINHALSIVYMIWVSLFFTKILYTSNDN
SKLIHNFSVLSILFHAYYVYVVFVNYIYTYHKQFRSSLFSFILFFHIFGVIGMIKLYYHD
YGRSLFAQCIIFYLINGFGITFGAHRLWSHRAFKAGTFVQVLFLILNSFANQGSVITWSK
NHRLHHKYSDTKYDPHNIRYGFFYSHVGWLLYQKTKYVKEKEKEIYVDDLLQNPLLLWQH
KLDPYFNFFFCFIVPGIYSYYMYNNFWDGFFILGALRWIITLHATWSINSASHSFGHRPY
NNDIKASNNIFTSIVALGEGCHNYHHVFPYCYAMNENFYILSINPTKYVIQFFYHLGLVW
DLKCAQNICKEVRLKEAEKLEKKNKLLSENIKNEIMKKEDTSYVTDLMNSLTALCNDYIN
ISTFRYITYLLRDFAIMMTILLIQVYYCYNKYGNGTLFSNMSKNFEGIESNKLISVSSFV
FFHIILYALPMGTMFASLYSLVYECKRGLLFKNQFLNNFFGSIISSFILLPYTSENSRKS
LLISLNEDFLKVLKGPIYFDLYSFIFTIFLGLYGLAIYIFGHFYFLIFFIAPYVVFNAWL
LTYIYLLNNPPFFTVDMNAKDVDISVLNYVVFQSLLEWKKNNSIYQSKKRLYKMVFFFLN
FIHHHLCYTHIVEFINSKIPSYRTKEIYKQFDKTLDQYHSLRNDKFIEILKQFL
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgagttacaaagcaaaaaacgccggagggaatttcagccccgtgggggaaaaaatgtgg
gaggctttaagcaaaagatacctggatatcgaacatgtaggaattatttatataacatat
gtcgtttttttggcatcctgctatatcttcagaaaatgtttctccaataagtttattcat
tttgtaaatgtttttaagggcctgctggttacgctcatatctttagtaagtttgaaatac
gttgatctgaacatcactttgggcattaacttgcttcatgtgtacaacattacgcagttg
tgtacctttttagagtccctttggaccaataagaaaaaaacaaatgaaaaatcaacgagt
caggagaacagagttgtccacaaatacgaaattagcaaagaaaatgaaaacgagtacaga
aatgaatacgaattgataggagatacttcgaaacacttagaacagttagcaaagaaaatt
ttaaagaacgaaaaaagtataaaagaaaatgaagggatcttaaaggaaaaagaaattata
gaagaaatcgagaaaaaagaaaaagaagaagaagaatatatgaaaaaaaaaaatacccat
gattctcagaaaaaaaaagacagatcagcatcaaatagtatttggatttacttttttttc
tcgcaaacattttatatattcttctacttttttttctggaaatatattcacaacatcatg
atcataaaggtatatttaactctacagctcagtaaaagtttgatttcgttagctagcaat
ttttatcataataatacaaacataaatttatttaaaagaattaatcacgctctcagcatt
gtttatatgatatgggtgagtctattttttacaaaaatactgtacacctctaatgataac
tcaaaattaattcataatttttcagtactttctatcctattccacgcatattacgtctac
gtagtcttcgtgaactatatatatacgtaccacaagcagtttagatcctccctattttca
ttcattttgtttttccatatattcggtgtaatcggcatgataaagttgtattaccatgat
tatggaaggtccttgtttgctcagtgcataatattttacttaataaacgggttcggcata
acattcggcgcacatcgtctgtggtctcatcgagcatttaaagcgggtaccttcgtgcag
gttctcttcctaattttgaacagttttgcaaaccaaggaagcgtaataacatggtccaaa
aatcatcgtctgcatcataagtacagtgataccaagtacgatccgcataacataagatat
ggattcttctatagccatgttggatggttattatatcagaagacaaaatatgtaaaggag
aaggagaaagaaatatatgtggatgatttattacagaacccacttctcctatggcaacat
aaattggatccatattttaacttttttttttgtttcattgtacctggaatatattcctat
tatatgtataacaatttctgggatggatttttcattttaggagcgctaagatggatcatc
acattacatgctacgtggtccatcaacagtgcctcgcattcatttggacatagaccctac
aataatgatataaaagcttcaaacaacatttttacctccattgtagcgctgggagaagga
tgccacaattaccatcatgttttcccgtactgctatgccatgaacgaaaacttctacatt
ctgagcataaatccaactaaatacgttattcaatttttttaccacttgggattagtatgg
gatttaaagtgtgcgcagaatatctgcaaggaagtacgtctaaaggaagcagaaaaatta
gagaagaaaaacaaattattaagcgaaaatattaaaaatgaaataatgaagaaagaagac
acaagctacgtaacagacctaatgaactcgttgacagcactttgcaatgactatataaac
atctccacctttaggtacatcacatatttattgagagattttgcaataatgatgacaatt
ttgctaattcaagtatactattgctataacaaatatggaaatggaactttattttcaaac
atgtctaaaaattttgaaggtatagagagcaacaagctaatttctgtaagttcatttgta
ttttttcacatcatattatatgccctacccatgggaaccatgttcgcaagtctgtattcc
ttggtttatgagtgcaagagaggattactttttaaaaaccaatttttaaataacttcttt
ggaagtattatttcgtcctttattcttctgccatatacatcggagaattcgagaaaatcg
ttgctgatatcgttgaacgaagattttctgaaagtgttaaagggacccatttattttgat
ttgtattcattcatatttaccatatttctgggattgtacggactggccatctacatattt
ggacacttttactttttaatatttttcatagcaccctatgtagtttttaacgcatggcta
ttaacatacatttatttgttgaataatccacccttttttactgtggacatgaatgccaag
gatgtcgatataagtgttttaaattacgtggtcttccaatccctccttgaatggaaaaag
aacaattccatttatcagagcaaaaaaagattgtacaaaatggttttcttcttcttaaat
tttatacaccatcatttgtgctatacacacattgtggagttcatcaattccaaaattccc
agttaccgaacgaaggaaatttacaagcagtttgacaaaacgttggaccagtatcactcc
ctgcgcaatgacaagtttattgaaattttgaagcagttcttatga

DBGET integrated database retrieval system