KEGG   Plasmodium knowlesi: PKH_102180Help
Entry
PKH_102180        CDS       T01094                                 

Definition
stearoyl-CoA desaturase (acyl-CoA desaturase,faty acid desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pkn  Plasmodium knowlesi
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PKH_102180
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PKH_102180
Enzymes [BR:pkn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PKH_102180
Lipid biosynthesis proteins [BR:pkn01004]
 Desaturase
  First
   PKH_102180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(join(1022832..1024592,1024723..1025826))
Genome map
AA seq 954 aa AA seqDB search
MSYKAKNAGGNFSPVGEKMWEALSKRYLDIEHVGIIYITYVVFLASCYIFRKCFSNKFIH
FVNVFKGLLVTLISLVSLKYVDLNITLGINLLHVYNITQLCTFLESLWTNKKKTNEKSTS
QENRVVHKYEISKENENEYRNEYELIGDTSKHLEQLAKKILKNEKSIKENEGILKEKEII
EEIEKKEKEEEEYMKKKNTHDSQKKKDRSASNSIWIYFFFSQTFYIFFYFFFWKYIHNIM
IIKVYLTLQLSKSLISLASNFYHNNTNINLFKRINHALSIVYMIWVSLFFTKILYTSNDN
SKLIHNFSVLSILFHAYYVYVVFVNYIYTYHKQFRSSLFSFILFFHIFGVIGMIKLYYHD
YGRSLFAQCIIFYLINGFGITFGAHRLWSHRAFKAGTFVQVLFLILNSFANQGSVITWSK
NHRLHHKYSDTKYDPHNIRYGFFYSHVGWLLYQKTKYVKEKEKEIYVDDLLQNPLLLWQH
KLDPYFNFFFCFIVPGIYSYYMYNNFWDGFFILGALRWIITLHATWSINSASHSFGHRPY
NNDIKASNNIFTSIVALGEGCHNYHHVFPYCYAMNENFYILSINPTKYVIQFFYHLGLVW
DLKCAQNICKEVRLKEAEKLEKKNKLLSENIKNEIMKKEDTSYVTDLMNSLTALCNDYIN
ISTFRYITYLLRDFAIMMTILLIQVYYCYNKYGNGTLFSNMSKNFEGIESNKLISVSSFV
FFHIILYALPMGTMFASLYSLVYECKRGLLFKNQFLNNFFGSIISSFILLPYTSENSRKS
LLISLNEDFLKVLKGPIYFDLYSFIFTIFLGLYGLAIYIFGHFYFLIFFIAPYVVFNAWL
LTYIYLLNNPPFFTVDMNAKDVDISVLNYVVFQSLLEWKKNNSIYQSKKRLYKMVFFFLN
FIHHHLCYTHIVEFINSKIPSYRTKEIYKQFDKTLDQYHSLRNDKFIEILKQFL
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgagttacaaagcaaaaaacgccggagggaatttcagccccgtgggggaaaaaatgtgg
gaggctttaagcaaaagatacctggatatcgaacatgtaggaattatttatataacatat
gtcgtttttttggcatcctgctatatcttcagaaaatgtttctccaataagtttattcat
tttgtaaatgtttttaagggcctgctggttacgctcatatctttagtaagtttgaaatac
gttgatctgaacatcactttgggcattaacttgcttcatgtgtacaacattacgcagttg
tgtacctttttagagtccctttggaccaataagaaaaaaacaaatgaaaaatcaacgagt
caggagaacagagttgtccacaaatacgaaattagcaaagaaaatgaaaacgagtacaga
aatgaatacgaattgataggagatacttcgaaacacttagaacagttagcaaagaaaatt
ttaaagaacgaaaaaagtataaaagaaaatgaagggatcttaaaggaaaaagaaattata
gaagaaatcgagaaaaaagaaaaagaagaagaagaatatatgaaaaaaaaaaatacccat
gattctcagaaaaaaaaagacagatcagcatcaaatagtatttggatttacttttttttc
tcgcaaacattttatatattcttctacttttttttctggaaatatattcacaacatcatg
atcataaaggtatatttaactctacagctcagtaaaagtttgatttcgttagctagcaat
ttttatcataataatacaaacataaatttatttaaaagaattaatcacgctctcagcatt
gtttatatgatatgggtgagtctattttttacaaaaatactgtacacctctaatgataac
tcaaaattaattcataatttttcagtactttctatcctattccacgcatattacgtctac
gtagtcttcgtgaactatatatatacgtaccacaagcagtttagatcctccctattttca
ttcattttgtttttccatatattcggtgtaatcggcatgataaagttgtattaccatgat
tatggaaggtccttgtttgctcagtgcataatattttacttaataaacgggttcggcata
acattcggcgcacatcgtctgtggtctcatcgagcatttaaagcgggtaccttcgtgcag
gttctcttcctaattttgaacagttttgcaaaccaaggaagcgtaataacatggtccaaa
aatcatcgtctgcatcataagtacagtgataccaagtacgatccgcataacataagatat
ggattcttctatagccatgttggatggttattatatcagaagacaaaatatgtaaaggag
aaggagaaagaaatatatgtggatgatttattacagaacccacttctcctatggcaacat
aaattggatccatattttaacttttttttttgtttcattgtacctggaatatattcctat
tatatgtataacaatttctgggatggatttttcattttaggagcgctaagatggatcatc
acattacatgctacgtggtccatcaacagtgcctcgcattcatttggacatagaccctac
aataatgatataaaagcttcaaacaacatttttacctccattgtagcgctgggagaagga
tgccacaattaccatcatgttttcccgtactgctatgccatgaacgaaaacttctacatt
ctgagcataaatccaactaaatacgttattcaatttttttaccacttgggattagtatgg
gatttaaagtgtgcgcagaatatctgcaaggaagtacgtctaaaggaagcagaaaaatta
gagaagaaaaacaaattattaagcgaaaatattaaaaatgaaataatgaagaaagaagac
acaagctacgtaacagacctaatgaactcgttgacagcactttgcaatgactatataaac
atctccacctttaggtacatcacatatttattgagagattttgcaataatgatgacaatt
ttgctaattcaagtatactattgctataacaaatatggaaatggaactttattttcaaac
atgtctaaaaattttgaaggtatagagagcaacaagctaatttctgtaagttcatttgta
ttttttcacatcatattatatgccctacccatgggaaccatgttcgcaagtctgtattcc
ttggtttatgagtgcaagagaggattactttttaaaaaccaatttttaaataacttcttt
ggaagtattatttcgtcctttattcttctgccatatacatcggagaattcgagaaaatcg
ttgctgatatcgttgaacgaagattttctgaaagtgttaaagggacccatttattttgat
ttgtattcattcatatttaccatatttctgggattgtacggactggccatctacatattt
ggacacttttactttttaatatttttcatagcaccctatgtagtttttaacgcatggcta
ttaacatacatttatttgttgaataatccacccttttttactgtggacatgaatgccaag
gatgtcgatataagtgttttaaattacgtggtcttccaatccctccttgaatggaaaaag
aacaattccatttatcagagcaaaaaaagattgtacaaaatggttttcttcttcttaaat
tttatacaccatcatttgtgctatacacacattgtggagttcatcaattccaaaattccc
agttaccgaacgaaggaaatttacaagcagtttgacaaaacgttggaccagtatcactcc
ctgcgcaatgacaagtttattgaaattttgaagcagttcttatga

DBGET integrated database retrieval system