KEGG   Plasmodium knowlesi: PKH_103040Help
Entry
PKH_103040        CDS       T01094                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase (CMK)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pkn  Plasmodium knowlesi
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PKH_103040
Enzymes [BR:pkn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PKH_103040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
10:1395116..1396642
Genome map
AA seq 508 aa AA seqDB search
MKYYFYVRIVLLLYVCLLYTIVESKNVLTDQRQFVRERCKHLRGVSLHFLLSTPCNNVAR
GKYAIKREWSSVKLSNRAKCRRKRNKMNVNSGTTGLQYEDDGTFQRGNIVCNKKMKLIIQ
QLNRTKWYDLKFFSPAKVNLFLRLKERKETHNELSTLMHTINLGDDIFITALSKEDQRKL
SELLFPCRSGDFLTIQKDEENEGENKNEEMNPERKDEDTSYYYNHYPLNDDNIIAKVLRR
YREELDIQEDVKFLIHIVKRIPIFSGVGGGSSNGASIFYFLEKYYYKYLKTDHLRNEFLK
TIGSDISFFSSSGFAYCTGKGNDVIDLCDAQATISGRRIYIFQIGEGLSSKLVYQHVDYN
QIVQYNPVSLLKQFVINAEGCNAVKHVEEAERNYLKQFVPLDEKSQMNSFINDLEHSAFV
LLNKVKCLKDLLQNQNIFDTVTMSGSGSSLFALTKKNMSSDQERMHVKNLIKQVQEKLHI
PVKVYLCNALRKNEDLWYRPGELAERLA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatttttacgtgagaattgtactacttctatacgtgtgtttgctttataca
attgtagaatccaaaaatgttttgactgatcaaaggcaatttgtgagagaaagatgcaag
cacttgaggggagtgtctttgcatttccttctttccactccatgtaataatgttgctagg
ggtaaatatgctataaagagggaatggtcttctgtcaaattgagtaaccgtgcaaagtgc
agaagaaagaggaacaaaatgaacgtcaactctggtacaacaggtctgcaatatgaagat
gatggtacattccaaaggggaaacatcgtatgcaataaaaaaatgaagttaataattcaa
caactcaacagaaccaagtggtatgacttaaaattcttttcccccgcaaaagttaattta
tttttaagactgaaagaaagaaaggagacgcacaatgaattatcaactctgatgcatacg
ataaatctaggcgatgatatttttataactgctctgagtaaggaggaccaaaggaagtta
agtgagctactatttccgtgtcgatcgggtgatttcttaaccatacagaaagatgaagaa
aacgaaggggagaacaaaaatgaggaaatgaatccagagaggaaagacgaagacacgagt
tattattacaaccattacccattaaatgatgataacataattgcaaaggtgttgagacga
tacagagaagaactagacatacaggaggatgtcaaatttttaattcatatagtgaagcgc
attcccatttttagtggagtcggtggaggatcgtctaatggagcttccattttttatttc
ttggaaaaatattactacaaatacttaaaaaccgatcatttaagaaacgaatttttaaaa
acaataggcagtgacatatccttctttagtagctccggttttgcctactgtactggcaag
ggaaatgatgtcatcgatttatgtgatgcccaggcaacaatttcggggcgcagaatatat
atttttcaaataggtgaaggactctcgtctaagttggtctatcaacatgttgattataac
cagatagtgcagtataaccctgtgagcttgttgaaacagttcgtaattaacgcggagggg
tgtaatgcagtcaaacacgtggaagaagcagagcgcaattatttgaagcagttcgttccg
ctggacgagaaatctcaaatgaatagttttataaacgacttggaacactctgcatttgtt
ttgcttaataaggtgaaatgtttgaaggacctcctccagaatcagaacattttcgatact
gtaacgatgagtggaagcggttcatcgttatttgcactaacaaagaagaatatgagttca
gatcaggagaggatgcacgtaaaaaatttgataaagcaagttcaggaaaagttacatata
cctgtaaaggtttatttgtgtaacgctttaaggaagaatgaggacctgtggtataggccg
ggcgaactcgcggagaggttggcctaa

DBGET integrated database retrieval system