KEGG   Plasmodium knowlesi: PKH_110300Help
Entry
PKH_110300        CDS       T01094                                 

Definition
NADH-cytochrome b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pkn  Plasmodium knowlesi
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pkn00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
11:complement(join(139407..139678,139928..140735))
Genome map
AA seq 359 aa AA seqDB search
MKQTLQEGLNFLSKNVVNIVILVMSISYVVLFVRKNKNGKEKADDLFELYMKANENEELK
EEGENGGSMQKAFLDENSKALKLSKIVKLTNTVRIFIFSYPWEYSNFGLGICKHIKFNGP
NQQGKIKGKWNDRDDREKDAKEIFRSYTPIYVDKKKKEVHFVIRIYHPDRKFVDGGKMSV
HLEKMRNNEMVKIAGPFGVLDYKGSNKFTYLSKVVQIKRHIVMIAGGTGMAPFFRLIKHM
LLFDDREGEHPFVTLIYANRNEEEILLKEVFDEYERTFERFKAVYSIDECLDPAKRDTFE
NVGYLTENLLRKYILKYHKLDIEVENSDTLILMCGPPPMTAFLKKVLKEDIKMENVITI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagactttgcaagaaggcctaaacttcctctcaaagaatgtggtgaatatcgta
attttggtaatgtctataagttatgttgtcctatttgtaaggaaaaataaaaatggaaaa
gaaaaagcagatgatctgtttgaactttatatgaaggcgaatgagaatgaagagttgaaa
gaggaaggggagaatggaggatccatgcagaaggcgttcttggatgaaaatagcaaagcg
ttgaagctgagcaaaattgtaaagcttacgaacacagtaaggattttcattttttcctac
ccgtgggaatatagcaatttcgggttaggtatatgtaaacatataaaatttaacggcccc
aatcagcaggggaaaataaaaggaaaatggaatgatagggatgacagagaaaaggatgcg
aaagaaattttccgaagttacactcctatttatgtagataaaaagaagaaggaggttcac
tttgtcattcgaatataccacccagatcgaaagtttgttgatggtggtaaaatgagtgtc
catttggaaaaaatgcgaaacaatgagatggttaaaattgcgggtccctttggggtttta
gattataaggggagtaacaaatttacttacttgtccaaggttgtgcagattaagaggcac
atcgttatgattgccgggggaaccggcatggctcccttttttcggctcataaagcacatg
ctcctctttgacgatagggagggtgagcacccattcgtgacactcatctacgcaaacagg
aacgaggaggaaattctactaaaggaggtttttgacgaatacgagcgaacattcgaacgg
ttcaaagcagtgtacagcatagacgagtgtctggaccccgccaagagggacacgttcgaa
aatgtaggatacctaacggaaaatcttttgcgcaagtacattctcaagtatcataagcta
gacatcgaagttgaaaacagcgacacactcattttgatgtgcggccctccccccatgaca
gctttccttaagaaggttctgaaggaggacattaaaatggaaaatgtcataacgatttag

DBGET integrated database retrieval system