KEGG   Plasmodium knowlesi: PKH_110300Help
Entry
PKH_110300        CDS       T01094                                 

Definition
NADH-cytochrome b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pkn  Plasmodium knowlesi
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PKH_110300
Enzymes [BR:pkn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PKH_110300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
11:complement(join(139407..139678,139928..140735))
Genome map
AA seq 359 aa AA seqDB search
MKQTLQEGLNFLSKNVVNIVILVMSISYVVLFVRKNKNGKEKADDLFELYMKANENEELK
EEGENGGSMQKAFLDENSKALKLSKIVKLTNTVRIFIFSYPWEYSNFGLGICKHIKFNGP
NQQGKIKGKWNDRDDREKDAKEIFRSYTPIYVDKKKKEVHFVIRIYHPDRKFVDGGKMSV
HLEKMRNNEMVKIAGPFGVLDYKGSNKFTYLSKVVQIKRHIVMIAGGTGMAPFFRLIKHM
LLFDDREGEHPFVTLIYANRNEEEILLKEVFDEYERTFERFKAVYSIDECLDPAKRDTFE
NVGYLTENLLRKYILKYHKLDIEVENSDTLILMCGPPPMTAFLKKVLKEDIKMENVITI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagactttgcaagaaggcctaaacttcctctcaaagaatgtggtgaatatcgta
attttggtaatgtctataagttatgttgtcctatttgtaaggaaaaataaaaatggaaaa
gaaaaagcagatgatctgtttgaactttatatgaaggcgaatgagaatgaagagttgaaa
gaggaaggggagaatggaggatccatgcagaaggcgttcttggatgaaaatagcaaagcg
ttgaagctgagcaaaattgtaaagcttacgaacacagtaaggattttcattttttcctac
ccgtgggaatatagcaatttcgggttaggtatatgtaaacatataaaatttaacggcccc
aatcagcaggggaaaataaaaggaaaatggaatgatagggatgacagagaaaaggatgcg
aaagaaattttccgaagttacactcctatttatgtagataaaaagaagaaggaggttcac
tttgtcattcgaatataccacccagatcgaaagtttgttgatggtggtaaaatgagtgtc
catttggaaaaaatgcgaaacaatgagatggttaaaattgcgggtccctttggggtttta
gattataaggggagtaacaaatttacttacttgtccaaggttgtgcagattaagaggcac
atcgttatgattgccgggggaaccggcatggctcccttttttcggctcataaagcacatg
ctcctctttgacgatagggagggtgagcacccattcgtgacactcatctacgcaaacagg
aacgaggaggaaattctactaaaggaggtttttgacgaatacgagcgaacattcgaacgg
ttcaaagcagtgtacagcatagacgagtgtctggaccccgccaagagggacacgttcgaa
aatgtaggatacctaacggaaaatcttttgcgcaagtacattctcaagtatcataagcta
gacatcgaagttgaaaacagcgacacactcattttgatgtgcggccctccccccatgaca
gctttccttaagaaggttctgaaggaggacattaaaatggaaaatgtcataacgatttag

DBGET integrated database retrieval system