KEGG   Plasmodium knowlesi: PKH_120960Help
Entry
PKH_120960        CDS       T01094                                 

Definition
aspartate transcarbamoylase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pkn  Plasmodium knowlesi
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PKH_120960
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PKH_120960
Enzymes [BR:pkn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PKH_120960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:complement(join(420796..420927,421212..421709,421943..422431))
Genome map
AA seq 372 aa AA seqDB search
MIELFGPLALVFTLLLAVVLAHITVGAKKKKLIIDRKGELNNKYKIDFDLIAQQMKFKNV
INIDDISHEELLVILFTAKKFESLLKNKEDTKFLDNKVFCSIFLEPSTRTRCSFDSAILR
LGSKVINITDMNSTSFYKGETVQDAFTILAKYVDGIIYRDPSNNNVDLAVASSDKPIINA
GNGTGEHPTQSLLDFYTIYNFFPHILERDINQKINVAFVGDLKNGRTVHSLSKLLSRYNV
NFNFISCKSLDIPENIVHIITNNLKKNNFYNENSIRKFDNLEKGLKDAHVIYMTRIQKER
FTDLNEYNVYKDAFILDNHVLKNTRMDAKVLHPLPRVNEINVEVDNNPKSVYFLQAENGL
YVRMALLYLIFS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgatagaattatttggcccactggctttagtgttcacgcttttattagctgtggttctg
gcgcacataaccgtaggtgcaaaaaaaaagaaattaatcatcgacagaaaaggagagctg
aacaataaatacaaaattgattttgatttaattgcgcaacaaatgaaatttaagaacgta
ataaatatcgatgatataagtcacgaggaattgttagtaattttgttcaccgccaaaaag
tttgaatctttgctaaaaaataaggaggacaccaagttcctggacaataaagttttctgt
agtatcttcctggagcctagtacaagaacgagatgttccttcgactcagccattttgaga
ctgggttcgaaggtgataaatattacggacatgaattccacgtccttttacaagggtgaa
actgtccaggacgcgtttaccattttggctaaatacgtggatgggattatataccgcgat
ccctcgaataataacgtggaccttgccgtcgcctcatccgacaagccaatcatcaacgca
ggaaatggcacaggtgaacacccaacgcagtcactgctagacttctacaccatatacaac
ttcttcccacacattttggaaagagacataaaccaaaaaattaatgtcgcctttgtcgga
gatttaaaaaatggaaggactgtccactcacttagcaaattacttagcagatataatgtc
aattttaactttatatcatgcaagtcgctggacattccagaaaacattgtccatattata
acgaacaatttgaaaaagaataatttctacaatgaaaattctatcagaaaatttgacaat
ttggagaaaggattaaaagacgcacatgtgatatacatgacgaggatacagaaggaaaga
tttacggacttaaacgagtacaatgtgtataaggacgccttcattctggataaccatgtt
ttgaagaataccaggatggatgcaaaggtcctacacccccttcctagggttaacgaaata
aatgtggaagttgataacaaccccaaaagtgtgtacttcttgcaggccgaaaacgggttg
tatgtgaggatggccctgttgtatctaatcttttcgtaa

DBGET integrated database retrieval system