KEGG   Plasmodium knowlesi: PKH_123270Help
Entry
PKH_123270        CDS       T01094                                 

Definition
protein disulfide isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PKH_123270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:join(1380681..1381793,1381960..1382287,1382528..1382634,1382816..1382899)
Genome map
AA seq 543 aa AA seqDB search
MKIIKLLLSILIIINACRTTNDEEKQNKILSIDMNDLEEILNDDKIFTFLIVYTHWCQRS
SLLLENVQTISNLLKYDSNVKIAKMNVAMNSTVIEKLSVYSVPSLFMLKKNETHRYIGVN
NIRGIMSWIYQYLDYSVYSIENKNKLDIFLQLDQYNNSILFFINRKENETHLLKELVNIC
TLIGDTFCFAVTNPNIISYFENEVMREKYHFNLENLKNKDMYGILFKNDDFGEYFYLIDN
NVNLLYNPGYSVQEKKLELTKWIQEKMEPLVIKFCEYYFPIFFANDTVTLFILYNDISDL
KKSDIIKCAKKYPHITFSVSGNKDAYEKRLLSELLIEEVTKPVMRITEFKNHITVPYKYR
PMSDDIEINEQSIDEFIQDYANEKKYFYRKSEKALPDEFNHGYVKIIVADTYDEYVFDNT
KHVVVLYYAPWCGHCYKFEPVYREIGKRLKLYAKKFKDYNNDVVISKIDAVNNEIYDILI
EGYPTIYLYTKENKKAPIQYNGPRTVESIISWICEKTNANIDIQEFRNINLDDEQLFETY
EEL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataatcaagctactactatccatcctaatcataatcaacgcatgtagaacgacg
aacgatgaagagaagcagaacaaaatactgtccatagacatgaacgacctggaggagata
ctaaatgatgataaaatttttaccttcctaattgtgtacacacactggtgtcaaagatcc
agtttgctcctcgaaaatgttcagaccatttcgaatcttttaaaatatgatagcaatgtg
aagatagccaaaatgaacgttgctatgaatagtaccgttattgaaaagctttccgtttac
agtgtaccctccctttttatgttaaaaaaaaatgagacgcatagatacataggagtaaac
aacatcagaggcataatgtcatggatatatcaataccttgactacagtgtatactcgatt
gaaaataaaaataagttggatatattcctccaactcgatcagtataataactccattttg
ttctttatcaacagaaaggaaaacgaaacccatctgcttaaagagctagtcaatatatgt
accctaataggggataccttctgcttcgctgttactaacccaaatatcatctcatatttt
gaaaatgaagtgatgcgagaaaaatatcactttaatttagaaaatttaaaaaacaaagac
atgtatggaattttattcaaaaatgatgatttcggtgagtacttttatttgatcgataac
aacgttaaccttttatacaatcctggttactctgtacaggaaaaaaagctggaactaaca
aaatggatacaggaaaaaatggaacccttggttattaaattctgtgagtattatttcccc
atttttttcgcaaacgacacggttactttatttatcctatacaacgatataagtgatctc
aagaaatcagatattataaagtgtgcgaagaagtacccccatatcaccttctccgtgtct
ggaaataaggatgcgtacgagaagaggctcctgagcgagctacttatcgaggaagtcaca
aagcccgtcatgcgaatcaccgaatttaagaaccacatcaccgttccgtacaagtacagg
cctatgagcgacgacatcgagataaacgagcagagcatcgacgaattcatccaggactac
gccaacgaaaagaagtacttctaccgaaaaagcgagaaagcgctaccagacgaattcaac
cacggatacgtaaaaataatagtggccgacacctacgatgaatacgtgtttgacaacacc
aagcacgtcgtggtgctctactacgcgccctggtgtggtcactgctacaaatttgagcct
gtgtacagggaaataggaaagagactcaaactatacgcaaaaaaattcaaggattacaac
aacgacgtggtcattagcaaaatagacgcggtgaacaacgagatatacgacattctaatc
gaaggttaccccaccatttacctatacacgaaggagaacaagaaggcgcccatccaatac
aacggcccaaggaccgtggaaagcataatttcgtggatttgcgaaaagaccaatgccaat
atagacatacaggaattccgtaacataaatttggacgatgaacaacttttcgaaacatat
gaggaactgtaa

DBGET integrated database retrieval system