KEGG   Plasmodium knowlesi: PKH_123560Help
Entry
PKH_123560        CDS       T01094                                 

Definition
(RefSeq) biotin carboxylase subunit of acetyl CoA carboxylase
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
pkn  Plasmodium knowlesi
Pathway
pkn00061  Fatty acid biosynthesis
pkn00620  Pyruvate metabolism
pkn00640  Propanoate metabolism
pkn01100  Metabolic pathways
pkn01110  Biosynthesis of secondary metabolites
pkn01130  Biosynthesis of antibiotics
pkn01212  Fatty acid metabolism
Module
pkn_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PKH_123560
   00640 Propanoate metabolism
    PKH_123560
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PKH_123560
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PKH_123560
Enzymes [BR:pkn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     PKH_123560
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PKH_123560
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PKH_123560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-GeneID: 7322292
NCBI-ProteinID: XP_002260166
UniProt: A0A1A7VTT8 B3L960
Position
12:complement(join(1481244..1481493,1481643..1481857,1481969..1490269))
Genome map
AA seq 2921 aa AA seqDB search
MVNGLTGAFSLVLLFQNFVEPIKYNNTNCYVHMHNNVNRNNLINTETREVYQSRIKGTKN
ILHESYRNRYVPLFVSKGTELLSSFFKNNRRRSGDNSTNISKNGKKSSPSSFKENNSPRA
TICRSSSGRKWDSSKGTAEQNVAHEKECTEQKRTIEELTDELLSSLSSHTDEGFMSVTSI
DRNNRNYIPGKTHHPRNMNNENGKSDDNLYTNSASYSPGKMSDVFSNGDFAKESVRRKNN
IEDNLTFMMDLIKESSPIPYKGGDVIIPQDRSGDVLMDGRRLNKGKVKKRKKHLNRLYYS
FRGHNDFLSRKEGTHGGDVCLGPVSNSPVQQKERNPLQGRVHRTKAQNFHDGENDFASPA
IHSSDSNDFLTYEEKERAKEKAYREYTKYIEERRYPYFNFVKNKNGKIIKKLLIANNGMA
AMKCILSIKEWLFKSFSEENLIKIIVLATEEDISSNAKYISFANKVIKVPPGKNSNNYAN
VQLIVDIAKKEQVDAVWPGWGHCSENPLLSTMLEKENIIFIGPTGDVMEALGDKISANIL
AQSVNVPVVKWSGDSIRVDNFDKKISEDIYNKSTIHSLDACIKECQRIGYPVMIKASQGG
GGKGIRKVENEEEIKKAYTQVQMELPNSPIFLMKVCSNVRHIEIQVVGDMYGNVCSLSGR
DCTTQRRFQKIFEEGPPSVVPPNIFREMEKASIRLTKMIKYRGAGTIEYLYDQEKQTYFF
LELNPRLQVEHPVSEGITNTNLISIQLQVAMGIPLQNIDDIRRLYRIGEGHGDASFRSPI
GAFHRLGSPCDYTPPPNGTSESSGGASIDCDDGSKNGGDQTNEFSPARAEQMDPFDFYNN
RPHVSNHVIAARITAENSNDSFKPTSGKVKRIHFQNSNDVWGYFSINDGSVHEFSDSQIG
HIFAKGETREVARKNLILALRKLNIDGEIKTGTKYLAKILECKPFIENNITTNWLDTIIE
KKKYIYYSAVHIIILCATIFKLLIHFIKEKEVIEDALNREDIGIKPQEDAFTNLKREVKN
AYVFDIVFENVRYNFKGYNTGENLYTLKINGQEIEVLADYDKKNNKIFASFFNHTYLYTC
LEDSLGIHMHLDKDSIFIPKISNPFHLVSNTNGKIVKYLIKDGEKIEKNEDYIEVEAMKM
IMTFKSTEKGILRHKMSEGTIVKIGDLLGVIEENSLDSNTQRGEKNEIKTFTGHLDLSNK
YAYELEEASRLSYPIKGENVMLGSVPTYESTEGVWPISDQKMGRGHLYKGTANCDDEGTL
RVVPNHASNEMHRLSENAAGTQHGMDATKSEDTSFFSSFEQDEVSSKEGITKNRLFLKQR
KNIFRLFASKKTSDKKEHTAASYVNEKFNSFKEYLTSLSSSDERSAAPTSVSTSVKVEAD
VDESAQMGVDVAAESNKSYSNSESRECANESSSAHTVNDESGSAHQGKNSTGLNSTCENS
STSERRNRNENSSSEVVSTRNASNEKTSNEGTLNWGTENKEASKTSSKSSSKSSSKSASK
SASEGTFKCTSNSRTQVGGDTPGVDSPGGHPSTAEEPRKEQFLLDIPNMKRVEYLLKGYE
QDYEECFNQLVKNKRNFIPNIIYILKKFIEYNSLFAEEENITQVEVYDILHTKFRNEKKK
KYEIAHAYTYNYLSIKFVLLVLKYLLDSGLSSLSEVPNDLLDKLKVITSFRGKLFGNIIL
LTRAIVHMAERMRLVDLVKGALNDRSHLSGDKISQLEEHIKIKQSIITRSRLGQFSTDTF
TPSSTLISYRNYCERVVNTFLGSPSDVHMFLPSLFTTENKSTLLEIYVQNLYKHFDIKTE
LVRDDCLKFFINNSEEENLLILNEKGTVYVDEFMDKGGMNPTDGRIKSIHIINRNEHFPN
DYEGSVEHIKNMCKHLYIYHYFGERYGDVYEWGGEGYSGEEIHSGRRTNLLPYQRYIFSF
EKNCQNYDLESVDEKIFKGTKVFLGMYKKNKKIQSLFAERVIHVCNLPKGEVSVLRETPP
KGENIMARQDLSHVMEKEWFQDALTEEFKEAVNDIKIARLNPKVQDARLSSYITYHIVLD
EVKDNDADELNIIVEALKNFLNRHNEFLLENYVNDVYACVYRKGGESAKGRLKLEPKKIL
RLHVLFDGENNVIEEVGSVPIFDVDALYLKRKRARDIDTLYAYDFVKAINISLNRMNNGG
SKDLFTYVNSVKEFKLDLEALHGVEDSKAEGNIAKQSMCHTGGLFPRHDGLSEDEVKIRN
ALYLSDKLNVGQNKLSVIGLLMNVKTIEYKEGRDVIFIINDITTHGGSFSVVEDQLFYAI
SSYAREKKIPRIYISCNSGARIGLYNFLMDKIQVSWKDEEKKELGYDYIYITEEVKNKIS
KEDIIFLKEVIKNGEKRYIIEGIVGNLNNHIGVENLRGSGLIAGETSKAYDEIFTLSYVT
GRSVGIGAYLVRLGKRTIQKKGSSLLLTGFNALNKILGEKVYVSNEQLGGVKIMMRNGIS
QLEAHNDQDGVDKIFKWLSYVPKTSDHYYDVIEEVRQKTSGNSYYEQGKVESAEREVKKL
FEEEEKPTSEKEPPKVYFQRINDIDMDNIQNADVIELIKGTDTKQGFLDKNSYFEYMNEW
GKGIITGRGKLGSIPVGIIAVNRNLVTQDVPCDPALKTKAVRSTQAPCVFFPDNSYKTAQ
SIEDFNKENLPLFVFANWRGFSGGTMDMFNSILKFGSMIVNQLVNYKHPVFVYIPIWGEL
RGGSWVVVDETLNSQIIEMYADTNSKGGILEPPGIVEVKFRLPEIRKLMHGIDSSIITLD
KRLSEAQEDGVSKIKQEIEDKEKELLPFYLQVCHRYADLHDVSKCMKSKGVIRKIVPWEK
ARSFFYYRLVRRLLMSTLSRKYGTSLTQSEEFKKLTSDITSSDEDDYEVCSKILNENTLR
DIERLTKDLHHQKTMDDFYRTFQSLPLQQRRELFSKLSSHQ
NT seq 8766 nt NT seq  +upstreamnt  +downstreamnt
atggttaatggcctcacaggagcattttcgcttgttctgttattccaaaactttgtagag
cccataaaatataacaacacgaattgctatgtacacatgcataataatgtcaatagaaac
aaccttatcaacacagaaacgagggaagtatatcagagtagaataaagggaaccaagaat
attcttcatgagagttacaggaacaggtatgtaccactcttcgtgtccaaaggaaccgaa
ctgctaagttcgttttttaagaataatagacggagaagtggagataactcgacgaatatt
tcgaagaacgggaagaagagttcgccgtcttcgttcaaagagaataactccccgcgtgcc
actatatgcagatcttcaagtgggagaaaatgggactcaagtaagggtaccgcggagcaa
aatgttgctcacgagaaagagtgcactgagcaaaagaggacgattgaggaattaacagat
gaattgcttagcagcctcagtagtcacaccgatgaaggctttatgagtgtcacatcgatt
gatcgcaacaacaggaactacataccaggaaaaactcaccacccaaggaatatgaacaat
gaaaatgggaagagcgacgacaatctttatacgaattcagctagttacagcccaggaaaa
atgtccgatgtattctcaaacggggattttgccaaggagagtgtcagaaggaaaaacaac
atagaagacaatctcacttttatgatggatctgattaaggaatcctctcccataccttac
aagggtggcgatgtgatcattcctcaggatcgttcgggagatgtactaatggatggtaga
cggctaaacaaagggaaggtaaaaaagaggaagaaacatctgaacagactttattacagc
tttaggggccataatgattttctctcccgaaaggagggtacccatgggggtgatgtgtgt
ctcggcccggtaagtaactctcctgtacagcagaaggaacgaaacccgttacagggaagg
gtgcaccgtaccaaggcgcagaattttcacgacggtgagaatgattttgcttctcctgcc
attcattcaagcgactccaacgatttcctaacatatgaagaaaaagagagggcaaaggaa
aaggcctatagggaatacacaaagtacatagaggagagaaggtacccatattttaatttc
gtaaaaaataagaatgggaagataataaaaaaattactaattgcaaataacggcatggca
gcgatgaaatgcattttatcaataaaggaatggctatttaaatctttttctgaggaaaac
ttaattaagatcatagtgctagccacagaagaagacatatcaagcaatgcaaaatacatt
tcgtttgccaacaaagttataaaggtacctcctggaaaaaactccaacaactatgccaat
gttcagctaattgtggatatagcaaaaaaggaacaagtggatgccgtttggccaggatgg
ggacactgttcagaaaatcccctactctccaccatgttggaaaaggagaacatcattttt
ataggaccaactggagatgtaatggaagccttaggagataaaatatctgctaatattctg
gcacaaagtgtaaatgtaccagttgtaaaatggagtggagacagcatacgagttgataat
tttgataaaaaaattagtgaagatatatacaataaatctaccatacattccttagatgcc
tgtataaaggagtgccaacggattggataccctgttatgataaaagcatcacaaggagga
ggggggaaaggtattcggaaagtggagaacgaagaagaaataaagaaagcctacacacaa
gtgcaaatggaattacccaactcgcctatctttctaatgaaagtctgtagcaacgttaga
cacatcgaaatacaagttgttggggatatgtatggtaatgtatgctcccttagtggaaga
gactgcacgacccaaaggaggttccaaaaaatttttgaagaagggcccccctcagttgta
cctccgaatattttccgtgaaatggaaaaggcatccatacgtctaacaaaaatgataaaa
tatagaggtgcgggaactattgagtatttatatgaccaggagaagcagacttattttttt
ctcgaattaaatcctcgactgcaggtggaacaccccgtgtcggagggcatcaccaacacg
aatcttatttcgatacagctacaggtggccatgggaattcccctccagaatatagatgac
attaggaggttgtaccgaataggggaagggcacggggacgcgagttttcgttcgccgata
ggggcctttcacaggttaggttccccatgtgactacacccctcctccaaatggtacgagc
gaaagcagcggtggtgctagtattgactgcgatgatggtagtaagaatggaggagaccaa
actaatgaattctcccccgcccgcgcggaacagatggatccattcgacttctataataac
aggccacacgtgagcaaccacgtgattgccgccagaatcactgcagaaaatagcaacgac
agttttaagcccacttcgggaaaggtaaaaagaatccatttccaaaattcgaacgacgtg
tggggatacttctcaatcaatgatggatccgtgcatgaattttctgattcacaaattggg
cacatttttgcaaaaggagaaacgagagaagtagctagaaaaaatttaatcctcgcatta
aggaaattaaacatagacggagaaataaagacaggcacaaaatatttagcaaaaattttg
gaatgcaaaccatttattgaaaataacataacgacaaattggttggatacaattattgag
aaaaaaaaatatatatattacagcgcagtacatataataattttgtgtgccacgattttt
aaactactcattcattttatcaaggaaaaagaagttattgaagatgcgctcaatagagaa
gacattggaattaagccacaggaagatgccttcactaatttaaagagagaagtaaaaaat
gcgtacgtgtttgatatcgtatttgaaaatgtgaggtacaattttaagggctataacaca
ggggagaatctttatactctaaaaattaatggacaagaaatcgaagttttagcagattat
gataaaaagaacaataaaatatttgcgagctttttcaatcacacttatttgtatacatgt
ttagaagacagcttaggaatccacatgcatctggataaggacagtatttttatccccaag
attagtaacccatttcatttggtgtcgaatacgaatgggaaaattgtaaaatatttgata
aaggatggagagaagatagagaagaatgaagactatatagaagtcgaggccatgaaaatg
ataatgacatttaagtctacagagaagggtatactcaggcacaagatgtcggagggtacc
attgtaaaaataggggatctcctgggagtgattgaggaaaactctcttgatagtaacact
cagcggggagagaaaaacgaaattaaaaccttcactggacatttggacttatcgaataag
tatgcatacgagttagaggaagcaagtcgactgtcatatcccattaagggggaaaatgtt
atgctcggttctgtccccacgtatgagtctacggaaggtgtctggcccattagtgatcaa
aaaatgggaagaggtcatttgtataagggaactgcaaattgtgacgatgaagggacactg
agagttgtgccaaaccatgcgtcaaatgaaatgcatcgtctgagtgaaaatgctgctggg
acacaacacggtatggatgccaccaagtcagaggatacctccttcttctcctccttcgaa
caagacgaagtatcatccaaggaaggaatcacaaagaatcggctattcctaaagcagagg
aaaaatatattccgcttatttgcaagcaagaaaaccagtgataagaaggaacataccgca
gcgagttacgtgaacgagaaatttaattccttcaaggagtacctgactagtttgagttcg
tccgacgaaaggtcggcggcacccaccagtgtcagcacgagcgtcaaggtggaggcagat
gtggacgaatctgcgcagatgggagtggacgtagccgcggagtcgaacaaatcgtactcc
aattctgaatccagggagtgtgcgaatgagtcgtccagtgcacacacggtgaatgatgag
tcgggaagtgctcaccaggggaaaaactctactggccttaactcaacctgcgagaattct
tcaactagcgaaaggaggaaccgtaacgaaaattcgtcgagcgaagttgtgtccacgagg
aatgcctccaatgagaagacgtccaacgagggtacgctcaattggggcacggaaaataag
gaggcatcgaaaacttcatcaaaaagttcatcaaaaagttcatcaaaaagtgcatcaaaa
agtgcatcggaaggaactttcaaatgcacctccaacagtcgcacacaagtggggggggat
acgccgggggtggattctccaggtggtcacccgtccaccgctgaagaacccagaaaggaa
caattccttttagacatcccgaatatgaagagagtagaatatttactaaaaggatatgag
caggattacgaagaatgcttcaatcaattagtgaaaaataaacgaaacttcatccctaac
attatttacattttaaaaaagtttatagagtacaattcactatttgctgaagaagaaaac
atcacgcaggtagaagtttacgatattttgcacaccaagtttaggaacgagaaaaaaaaa
aaatatgaaattgcccatgcatatacctataactatttaagcataaaatttgttttatta
gttttaaaatacttactagacagtgggttatcttcactcagtgaagtgccaaatgacctt
ctggataaactaaaagtgataacatcctttagagggaaattatttggcaacataattcta
ctgacgagggcgatagtacacatggcggaacgtatgcgcttggttgatttggtaaaaggt
gcattaaacgataggagtcacctttctggtgataaaattagccaactggaggaacacata
aagataaagcagagcatcattacacggtcaagattgggacaattttcaactgatacattt
acgccctcttctactttgatcagctatagaaactattgcgaacgtgtagtgaatacattt
ttggggagtccttcagacgtgcatatgttccttccatccctttttaccacagaaaataag
agcactcttctagaaatatacgttcagaatttgtataaacactttgatatcaaaacggaa
ctagtgcgtgatgattgccttaaattttttataaacaattcggaagaagaaaatttactc
atcctaaatgagaaaggtactgtatatgtggatgaatttatggacaaagggggaatgaat
cctaccgatggacgtataaagagcattcatattattaacagaaatgaacatttccctaat
gactatgaaggaagtgtagaacatataaaaaatatgtgtaagcatttatacatttatcac
tattttggggagaggtacggggatgtttacgagtggggtggagagggatacagcggggag
gagatccactcagggcgaaggacaaatctgctaccctaccaaagatatattttttccttt
gaaaagaactgtcaaaattatgacctagaaagtgtagatgagaaaatatttaaaggtacc
aaagtattcctcgggatgtacaaaaagaataaaaaaatccagtcgctatttgcagagagg
gtgatccatgtgtgtaatcttccaaagggtgaagtgtctgtactgagggaaactccacca
aaaggggagaatatcatggcaagacaggacttatcccatgtgatggagaaggagtggttc
caagacgcactcacagaagaatttaaagaagcggtcaatgatataaaaatagctagactg
aacccgaaagtgcaggacgcaaggctcagcagctacataacttaccatatagtactagat
gaagttaaagacaatgacgcagacgaattaaatataattgtagaggcgttgaagaacttc
ctcaataggcataacgagtttcttctagaaaactacgtgaacgatgtatatgcatgtgtt
tacagaaagggaggagaatctgccaaggggagactcaaattggaaccaaaaaaaatacta
agattgcacgtgctgtttgatggagaaaataatgtaatcgaggaagttggaagtgtaccc
atctttgacgttgacgcgttgtacttaaaaagaaaaagggctagagatatagatacgcta
tatgcctacgattttgtgaaggctataaatatttccctaaacaggatgaataacggagga
tccaaggatctgttcacatatgtgaatagcgtaaaggagtttaagctcgacttggaggca
ctacatggagtggaagattccaaggcggagggtaacatagcgaagcaatccatgtgtcat
acgggtgggttgtttcctcggcatgatggcctcagcgaagacgaagtaaagataagaaac
gcgctgtatctgtcagacaagctaaacgtaggccaaaacaaactgagcgtcattggtctg
ttgatgaacgtgaagacaatcgaatacaaagaaggcagagatgtcatttttatcataaat
gatataactacccatggtggctcattcagtgtagtggaagatcagttattttatgccata
tctagctacgcgagggagaagaaaattccgcgcatttatatatcgtgcaattcaggtgca
agaattgggctgtacaattttttgatggataaaattcaagtcagttggaaagacgaagaa
aagaaggaactggggtatgattatatttatataacagaagaggtcaaaaataaaatatcc
aaggaagacataatatttttaaaggaagttattaaaaatggggagaaaagatacataatt
gaaggtatagtaggaaacttaaataaccatattggagtggaaaatttaagggggagtggt
cttatcgctggtgaaacatccaaagcatatgatgaaatttttaccctatcatatgttacc
ggaagaagtgttggcatcggtgcttaccttgttaggctcgggaaaagaaccatccagaag
aaaggctcttcccttttactaacagggtttaatgccctaaataaaatattaggagaaaag
gtctatgtcagcaatgagcaattgggaggggtaaaaattatgatgagaaatggcatatct
caactagaagctcacaatgatcaggatggtgtggacaaaattttcaagtggctatcctat
gtacccaaaacgagtgaccattattatgatgttattgaggaggtgcgccagaagacaagt
ggaaatagctactatgagcagggtaaggtagagagcgcagaaagggaagtaaagaaactt
ttcgaggaggaagagaaacccacatcggagaaggaacctccaaaagtgtacttccaaaga
attaacgacatagacatggataacatacaaaacgcagatgtaatagaacttataaaggga
acagacacgaagcagggattcttagacaaaaatagctatttcgaatacatgaatgaatgg
ggaaaagggataataacggggaggggaaaattgggttccatcccggtgggaattatagct
gttaacagaaatttagtaacgcaagatgttccgtgcgatccagcattgaagaccaaagca
gtgagatcaacacaagcaccatgtgtttttttcccggacaattcatataaaactgctcag
tctattgaagattttaataaagaaaatttacccctatttgtttttgccaattggagaggg
ttttcaggtggtacaatggatatgtttaacagtattttaaaattcggatcaatgattgtt
aatcagttggttaattacaagcaccccgtttttgtgtacatcccaatttggggagagctg
agaggtggatcatgggttgttgtagacgaaacgttgaatagccaaatcatcgagatgtat
gcagatacgaacagtaaaggaggaattttggagccacccggaattgttgaggtgaagttt
aggttaccagaaataaggaagctgatgcacggtattgactcgtctataattactctggac
aagcggctgtccgaagcgcaggaggatggcgtgtctaaaataaaacaagaaatagaggac
aaagaaaaggagctattgccattttatttacaagtgtgccacagatatgcagatcttcac
gatgtgtcgaaatgcatgaagtccaagggagtgattaggaaaatcgttccttgggagaaa
gcccgctccttcttttactatcgcctcgtgcggcgcttgttaatgagcacgttgagcaga
aaatacggaacttctttgacccaaagtgaagaattcaaaaagctcaccagtgacatcacc
tcctccgacgaggacgactacgaagtgtgcagcaaaattttgaatgaaaatacgctgagg
gatatagagcgactaacgaaggatctgcaccatcagaaaacgatggacgacttttacagg
acctttcaaagtttgcccctacaacagagaagggaactctttagtaagctgagttcacat
cagtag

DBGET integrated database retrieval system