KEGG   Plasmodium knowlesi: PKH_123560Help
Entry
PKH_123560        CDS       T01094                                 

Definition
biotin carboxylase subunit of acetyl CoA carboxylase (EC:6.3.4.14)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pkn  Plasmodium knowlesi
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PKH_123560
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PKH_123560
   00640 Propanoate metabolism
    PKH_123560
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PKH_123560
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PKH_123560
Enzymes [BR:pkn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PKH_123560
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PKH_123560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:complement(join(1481244..1481493,1481643..1481857,1481969..1490269))
Genome map
AA seq 2921 aa AA seqDB search
MVNGLTGAFSLVLLFQNFVEPIKYNNTNCYVHMHNNVNRNNLINTETREVYQSRIKGTKN
ILHESYRNRYVPLFVSKGTELLSSFFKNNRRRSGDNSTNISKNGKKSSPSSFKENNSPRA
TICRSSSGRKWDSSKGTAEQNVAHEKECTEQKRTIEELTDELLSSLSSHTDEGFMSVTSI
DRNNRNYIPGKTHHPRNMNNENGKSDDNLYTNSASYSPGKMSDVFSNGDFAKESVRRKNN
IEDNLTFMMDLIKESSPIPYKGGDVIIPQDRSGDVLMDGRRLNKGKVKKRKKHLNRLYYS
FRGHNDFLSRKEGTHGGDVCLGPVSNSPVQQKERNPLQGRVHRTKAQNFHDGENDFASPA
IHSSDSNDFLTYEEKERAKEKAYREYTKYIEERRYPYFNFVKNKNGKIIKKLLIANNGMA
AMKCILSIKEWLFKSFSEENLIKIIVLATEEDISSNAKYISFANKVIKVPPGKNSNNYAN
VQLIVDIAKKEQVDAVWPGWGHCSENPLLSTMLEKENIIFIGPTGDVMEALGDKISANIL
AQSVNVPVVKWSGDSIRVDNFDKKISEDIYNKSTIHSLDACIKECQRIGYPVMIKASQGG
GGKGIRKVENEEEIKKAYTQVQMELPNSPIFLMKVCSNVRHIEIQVVGDMYGNVCSLSGR
DCTTQRRFQKIFEEGPPSVVPPNIFREMEKASIRLTKMIKYRGAGTIEYLYDQEKQTYFF
LELNPRLQVEHPVSEGITNTNLISIQLQVAMGIPLQNIDDIRRLYRIGEGHGDASFRSPI
GAFHRLGSPCDYTPPPNGTSESSGGASIDCDDGSKNGGDQTNEFSPARAEQMDPFDFYNN
RPHVSNHVIAARITAENSNDSFKPTSGKVKRIHFQNSNDVWGYFSINDGSVHEFSDSQIG
HIFAKGETREVARKNLILALRKLNIDGEIKTGTKYLAKILECKPFIENNITTNWLDTIIE
KKKYIYYSAVHIIILCATIFKLLIHFIKEKEVIEDALNREDIGIKPQEDAFTNLKREVKN
AYVFDIVFENVRYNFKGYNTGENLYTLKINGQEIEVLADYDKKNNKIFASFFNHTYLYTC
LEDSLGIHMHLDKDSIFIPKISNPFHLVSNTNGKIVKYLIKDGEKIEKNEDYIEVEAMKM
IMTFKSTEKGILRHKMSEGTIVKIGDLLGVIEENSLDSNTQRGEKNEIKTFTGHLDLSNK
YAYELEEASRLSYPIKGENVMLGSVPTYESTEGVWPISDQKMGRGHLYKGTANCDDEGTL
RVVPNHASNEMHRLSENAAGTQHGMDATKSEDTSFFSSFEQDEVSSKEGITKNRLFLKQR
KNIFRLFASKKTSDKKEHTAASYVNEKFNSFKEYLTSLSSSDERSAAPTSVSTSVKVEAD
VDESAQMGVDVAAESNKSYSNSESRECANESSSAHTVNDESGSAHQGKNSTGLNSTCENS
STSERRNRNENSSSEVVSTRNASNEKTSNEGTLNWGTENKEASKTSSKSSSKSSSKSASK
SASEGTFKCTSNSRTQVGGDTPGVDSPGGHPSTAEEPRKEQFLLDIPNMKRVEYLLKGYE
QDYEECFNQLVKNKRNFIPNIIYILKKFIEYNSLFAEEENITQVEVYDILHTKFRNEKKK
KYEIAHAYTYNYLSIKFVLLVLKYLLDSGLSSLSEVPNDLLDKLKVITSFRGKLFGNIIL
LTRAIVHMAERMRLVDLVKGALNDRSHLSGDKISQLEEHIKIKQSIITRSRLGQFSTDTF
TPSSTLISYRNYCERVVNTFLGSPSDVHMFLPSLFTTENKSTLLEIYVQNLYKHFDIKTE
LVRDDCLKFFINNSEEENLLILNEKGTVYVDEFMDKGGMNPTDGRIKSIHIINRNEHFPN
DYEGSVEHIKNMCKHLYIYHYFGERYGDVYEWGGEGYSGEEIHSGRRTNLLPYQRYIFSF
EKNCQNYDLESVDEKIFKGTKVFLGMYKKNKKIQSLFAERVIHVCNLPKGEVSVLRETPP
KGENIMARQDLSHVMEKEWFQDALTEEFKEAVNDIKIARLNPKVQDARLSSYITYHIVLD
EVKDNDADELNIIVEALKNFLNRHNEFLLENYVNDVYACVYRKGGESAKGRLKLEPKKIL
RLHVLFDGENNVIEEVGSVPIFDVDALYLKRKRARDIDTLYAYDFVKAINISLNRMNNGG
SKDLFTYVNSVKEFKLDLEALHGVEDSKAEGNIAKQSMCHTGGLFPRHDGLSEDEVKIRN
ALYLSDKLNVGQNKLSVIGLLMNVKTIEYKEGRDVIFIINDITTHGGSFSVVEDQLFYAI
SSYAREKKIPRIYISCNSGARIGLYNFLMDKIQVSWKDEEKKELGYDYIYITEEVKNKIS
KEDIIFLKEVIKNGEKRYIIEGIVGNLNNHIGVENLRGSGLIAGETSKAYDEIFTLSYVT
GRSVGIGAYLVRLGKRTIQKKGSSLLLTGFNALNKILGEKVYVSNEQLGGVKIMMRNGIS
QLEAHNDQDGVDKIFKWLSYVPKTSDHYYDVIEEVRQKTSGNSYYEQGKVESAEREVKKL
FEEEEKPTSEKEPPKVYFQRINDIDMDNIQNADVIELIKGTDTKQGFLDKNSYFEYMNEW
GKGIITGRGKLGSIPVGIIAVNRNLVTQDVPCDPALKTKAVRSTQAPCVFFPDNSYKTAQ
SIEDFNKENLPLFVFANWRGFSGGTMDMFNSILKFGSMIVNQLVNYKHPVFVYIPIWGEL
RGGSWVVVDETLNSQIIEMYADTNSKGGILEPPGIVEVKFRLPEIRKLMHGIDSSIITLD
KRLSEAQEDGVSKIKQEIEDKEKELLPFYLQVCHRYADLHDVSKCMKSKGVIRKIVPWEK
ARSFFYYRLVRRLLMSTLSRKYGTSLTQSEEFKKLTSDITSSDEDDYEVCSKILNENTLR
DIERLTKDLHHQKTMDDFYRTFQSLPLQQRRELFSKLSSHQ
NT seq 8766 nt NT seq  +upstreamnt  +downstreamnt
atggttaatggcctcacaggagcattttcgcttgttctgttattccaaaactttgtagag
cccataaaatataacaacacgaattgctatgtacacatgcataataatgtcaatagaaac
aaccttatcaacacagaaacgagggaagtatatcagagtagaataaagggaaccaagaat
attcttcatgagagttacaggaacaggtatgtaccactcttcgtgtccaaaggaaccgaa
ctgctaagttcgttttttaagaataatagacggagaagtggagataactcgacgaatatt
tcgaagaacgggaagaagagttcgccgtcttcgttcaaagagaataactccccgcgtgcc
actatatgcagatcttcaagtgggagaaaatgggactcaagtaagggtaccgcggagcaa
aatgttgctcacgagaaagagtgcactgagcaaaagaggacgattgaggaattaacagat
gaattgcttagcagcctcagtagtcacaccgatgaaggctttatgagtgtcacatcgatt
gatcgcaacaacaggaactacataccaggaaaaactcaccacccaaggaatatgaacaat
gaaaatgggaagagcgacgacaatctttatacgaattcagctagttacagcccaggaaaa
atgtccgatgtattctcaaacggggattttgccaaggagagtgtcagaaggaaaaacaac
atagaagacaatctcacttttatgatggatctgattaaggaatcctctcccataccttac
aagggtggcgatgtgatcattcctcaggatcgttcgggagatgtactaatggatggtaga
cggctaaacaaagggaaggtaaaaaagaggaagaaacatctgaacagactttattacagc
tttaggggccataatgattttctctcccgaaaggagggtacccatgggggtgatgtgtgt
ctcggcccggtaagtaactctcctgtacagcagaaggaacgaaacccgttacagggaagg
gtgcaccgtaccaaggcgcagaattttcacgacggtgagaatgattttgcttctcctgcc
attcattcaagcgactccaacgatttcctaacatatgaagaaaaagagagggcaaaggaa
aaggcctatagggaatacacaaagtacatagaggagagaaggtacccatattttaatttc
gtaaaaaataagaatgggaagataataaaaaaattactaattgcaaataacggcatggca
gcgatgaaatgcattttatcaataaaggaatggctatttaaatctttttctgaggaaaac
ttaattaagatcatagtgctagccacagaagaagacatatcaagcaatgcaaaatacatt
tcgtttgccaacaaagttataaaggtacctcctggaaaaaactccaacaactatgccaat
gttcagctaattgtggatatagcaaaaaaggaacaagtggatgccgtttggccaggatgg
ggacactgttcagaaaatcccctactctccaccatgttggaaaaggagaacatcattttt
ataggaccaactggagatgtaatggaagccttaggagataaaatatctgctaatattctg
gcacaaagtgtaaatgtaccagttgtaaaatggagtggagacagcatacgagttgataat
tttgataaaaaaattagtgaagatatatacaataaatctaccatacattccttagatgcc
tgtataaaggagtgccaacggattggataccctgttatgataaaagcatcacaaggagga
ggggggaaaggtattcggaaagtggagaacgaagaagaaataaagaaagcctacacacaa
gtgcaaatggaattacccaactcgcctatctttctaatgaaagtctgtagcaacgttaga
cacatcgaaatacaagttgttggggatatgtatggtaatgtatgctcccttagtggaaga
gactgcacgacccaaaggaggttccaaaaaatttttgaagaagggcccccctcagttgta
cctccgaatattttccgtgaaatggaaaaggcatccatacgtctaacaaaaatgataaaa
tatagaggtgcgggaactattgagtatttatatgaccaggagaagcagacttattttttt
ctcgaattaaatcctcgactgcaggtggaacaccccgtgtcggagggcatcaccaacacg
aatcttatttcgatacagctacaggtggccatgggaattcccctccagaatatagatgac
attaggaggttgtaccgaataggggaagggcacggggacgcgagttttcgttcgccgata
ggggcctttcacaggttaggttccccatgtgactacacccctcctccaaatggtacgagc
gaaagcagcggtggtgctagtattgactgcgatgatggtagtaagaatggaggagaccaa
actaatgaattctcccccgcccgcgcggaacagatggatccattcgacttctataataac
aggccacacgtgagcaaccacgtgattgccgccagaatcactgcagaaaatagcaacgac
agttttaagcccacttcgggaaaggtaaaaagaatccatttccaaaattcgaacgacgtg
tggggatacttctcaatcaatgatggatccgtgcatgaattttctgattcacaaattggg
cacatttttgcaaaaggagaaacgagagaagtagctagaaaaaatttaatcctcgcatta
aggaaattaaacatagacggagaaataaagacaggcacaaaatatttagcaaaaattttg
gaatgcaaaccatttattgaaaataacataacgacaaattggttggatacaattattgag
aaaaaaaaatatatatattacagcgcagtacatataataattttgtgtgccacgattttt
aaactactcattcattttatcaaggaaaaagaagttattgaagatgcgctcaatagagaa
gacattggaattaagccacaggaagatgccttcactaatttaaagagagaagtaaaaaat
gcgtacgtgtttgatatcgtatttgaaaatgtgaggtacaattttaagggctataacaca
ggggagaatctttatactctaaaaattaatggacaagaaatcgaagttttagcagattat
gataaaaagaacaataaaatatttgcgagctttttcaatcacacttatttgtatacatgt
ttagaagacagcttaggaatccacatgcatctggataaggacagtatttttatccccaag
attagtaacccatttcatttggtgtcgaatacgaatgggaaaattgtaaaatatttgata
aaggatggagagaagatagagaagaatgaagactatatagaagtcgaggccatgaaaatg
ataatgacatttaagtctacagagaagggtatactcaggcacaagatgtcggagggtacc
attgtaaaaataggggatctcctgggagtgattgaggaaaactctcttgatagtaacact
cagcggggagagaaaaacgaaattaaaaccttcactggacatttggacttatcgaataag
tatgcatacgagttagaggaagcaagtcgactgtcatatcccattaagggggaaaatgtt
atgctcggttctgtccccacgtatgagtctacggaaggtgtctggcccattagtgatcaa
aaaatgggaagaggtcatttgtataagggaactgcaaattgtgacgatgaagggacactg
agagttgtgccaaaccatgcgtcaaatgaaatgcatcgtctgagtgaaaatgctgctggg
acacaacacggtatggatgccaccaagtcagaggatacctccttcttctcctccttcgaa
caagacgaagtatcatccaaggaaggaatcacaaagaatcggctattcctaaagcagagg
aaaaatatattccgcttatttgcaagcaagaaaaccagtgataagaaggaacataccgca
gcgagttacgtgaacgagaaatttaattccttcaaggagtacctgactagtttgagttcg
tccgacgaaaggtcggcggcacccaccagtgtcagcacgagcgtcaaggtggaggcagat
gtggacgaatctgcgcagatgggagtggacgtagccgcggagtcgaacaaatcgtactcc
aattctgaatccagggagtgtgcgaatgagtcgtccagtgcacacacggtgaatgatgag
tcgggaagtgctcaccaggggaaaaactctactggccttaactcaacctgcgagaattct
tcaactagcgaaaggaggaaccgtaacgaaaattcgtcgagcgaagttgtgtccacgagg
aatgcctccaatgagaagacgtccaacgagggtacgctcaattggggcacggaaaataag
gaggcatcgaaaacttcatcaaaaagttcatcaaaaagttcatcaaaaagtgcatcaaaa
agtgcatcggaaggaactttcaaatgcacctccaacagtcgcacacaagtggggggggat
acgccgggggtggattctccaggtggtcacccgtccaccgctgaagaacccagaaaggaa
caattccttttagacatcccgaatatgaagagagtagaatatttactaaaaggatatgag
caggattacgaagaatgcttcaatcaattagtgaaaaataaacgaaacttcatccctaac
attatttacattttaaaaaagtttatagagtacaattcactatttgctgaagaagaaaac
atcacgcaggtagaagtttacgatattttgcacaccaagtttaggaacgagaaaaaaaaa
aaatatgaaattgcccatgcatatacctataactatttaagcataaaatttgttttatta
gttttaaaatacttactagacagtgggttatcttcactcagtgaagtgccaaatgacctt
ctggataaactaaaagtgataacatcctttagagggaaattatttggcaacataattcta
ctgacgagggcgatagtacacatggcggaacgtatgcgcttggttgatttggtaaaaggt
gcattaaacgataggagtcacctttctggtgataaaattagccaactggaggaacacata
aagataaagcagagcatcattacacggtcaagattgggacaattttcaactgatacattt
acgccctcttctactttgatcagctatagaaactattgcgaacgtgtagtgaatacattt
ttggggagtccttcagacgtgcatatgttccttccatccctttttaccacagaaaataag
agcactcttctagaaatatacgttcagaatttgtataaacactttgatatcaaaacggaa
ctagtgcgtgatgattgccttaaattttttataaacaattcggaagaagaaaatttactc
atcctaaatgagaaaggtactgtatatgtggatgaatttatggacaaagggggaatgaat
cctaccgatggacgtataaagagcattcatattattaacagaaatgaacatttccctaat
gactatgaaggaagtgtagaacatataaaaaatatgtgtaagcatttatacatttatcac
tattttggggagaggtacggggatgtttacgagtggggtggagagggatacagcggggag
gagatccactcagggcgaaggacaaatctgctaccctaccaaagatatattttttccttt
gaaaagaactgtcaaaattatgacctagaaagtgtagatgagaaaatatttaaaggtacc
aaagtattcctcgggatgtacaaaaagaataaaaaaatccagtcgctatttgcagagagg
gtgatccatgtgtgtaatcttccaaagggtgaagtgtctgtactgagggaaactccacca
aaaggggagaatatcatggcaagacaggacttatcccatgtgatggagaaggagtggttc
caagacgcactcacagaagaatttaaagaagcggtcaatgatataaaaatagctagactg
aacccgaaagtgcaggacgcaaggctcagcagctacataacttaccatatagtactagat
gaagttaaagacaatgacgcagacgaattaaatataattgtagaggcgttgaagaacttc
ctcaataggcataacgagtttcttctagaaaactacgtgaacgatgtatatgcatgtgtt
tacagaaagggaggagaatctgccaaggggagactcaaattggaaccaaaaaaaatacta
agattgcacgtgctgtttgatggagaaaataatgtaatcgaggaagttggaagtgtaccc
atctttgacgttgacgcgttgtacttaaaaagaaaaagggctagagatatagatacgcta
tatgcctacgattttgtgaaggctataaatatttccctaaacaggatgaataacggagga
tccaaggatctgttcacatatgtgaatagcgtaaaggagtttaagctcgacttggaggca
ctacatggagtggaagattccaaggcggagggtaacatagcgaagcaatccatgtgtcat
acgggtgggttgtttcctcggcatgatggcctcagcgaagacgaagtaaagataagaaac
gcgctgtatctgtcagacaagctaaacgtaggccaaaacaaactgagcgtcattggtctg
ttgatgaacgtgaagacaatcgaatacaaagaaggcagagatgtcatttttatcataaat
gatataactacccatggtggctcattcagtgtagtggaagatcagttattttatgccata
tctagctacgcgagggagaagaaaattccgcgcatttatatatcgtgcaattcaggtgca
agaattgggctgtacaattttttgatggataaaattcaagtcagttggaaagacgaagaa
aagaaggaactggggtatgattatatttatataacagaagaggtcaaaaataaaatatcc
aaggaagacataatatttttaaaggaagttattaaaaatggggagaaaagatacataatt
gaaggtatagtaggaaacttaaataaccatattggagtggaaaatttaagggggagtggt
cttatcgctggtgaaacatccaaagcatatgatgaaatttttaccctatcatatgttacc
ggaagaagtgttggcatcggtgcttaccttgttaggctcgggaaaagaaccatccagaag
aaaggctcttcccttttactaacagggtttaatgccctaaataaaatattaggagaaaag
gtctatgtcagcaatgagcaattgggaggggtaaaaattatgatgagaaatggcatatct
caactagaagctcacaatgatcaggatggtgtggacaaaattttcaagtggctatcctat
gtacccaaaacgagtgaccattattatgatgttattgaggaggtgcgccagaagacaagt
ggaaatagctactatgagcagggtaaggtagagagcgcagaaagggaagtaaagaaactt
ttcgaggaggaagagaaacccacatcggagaaggaacctccaaaagtgtacttccaaaga
attaacgacatagacatggataacatacaaaacgcagatgtaatagaacttataaaggga
acagacacgaagcagggattcttagacaaaaatagctatttcgaatacatgaatgaatgg
ggaaaagggataataacggggaggggaaaattgggttccatcccggtgggaattatagct
gttaacagaaatttagtaacgcaagatgttccgtgcgatccagcattgaagaccaaagca
gtgagatcaacacaagcaccatgtgtttttttcccggacaattcatataaaactgctcag
tctattgaagattttaataaagaaaatttacccctatttgtttttgccaattggagaggg
ttttcaggtggtacaatggatatgtttaacagtattttaaaattcggatcaatgattgtt
aatcagttggttaattacaagcaccccgtttttgtgtacatcccaatttggggagagctg
agaggtggatcatgggttgttgtagacgaaacgttgaatagccaaatcatcgagatgtat
gcagatacgaacagtaaaggaggaattttggagccacccggaattgttgaggtgaagttt
aggttaccagaaataaggaagctgatgcacggtattgactcgtctataattactctggac
aagcggctgtccgaagcgcaggaggatggcgtgtctaaaataaaacaagaaatagaggac
aaagaaaaggagctattgccattttatttacaagtgtgccacagatatgcagatcttcac
gatgtgtcgaaatgcatgaagtccaagggagtgattaggaaaatcgttccttgggagaaa
gcccgctccttcttttactatcgcctcgtgcggcgcttgttaatgagcacgttgagcaga
aaatacggaacttctttgacccaaagtgaagaattcaaaaagctcaccagtgacatcacc
tcctccgacgaggacgactacgaagtgtgcagcaaaattttgaatgaaaatacgctgagg
gatatagagcgactaacgaaggatctgcaccatcagaaaacgatggacgacttttacagg
acctttcaaagtttgcccctacaacagagaagggaactctttagtaagctgagttcacat
cagtag

DBGET integrated database retrieval system