KEGG   Plasmodium knowlesi: PKH_124190Help
Entry
PKH_124190        CDS       T01094                                 

Definition
cyclin
Orthology
K06634  
cyclin H
Organism
pkn  Plasmodium knowlesi
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PKH_124190
  Replication and repair
   03420 Nucleotide excision repair
    PKH_124190
Transcription machinery [BR:pkn03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PKH_124190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
12:complement(1793343..1794323)
Genome map
AA seq 326 aa AA seqDB search
MNYPEDTSHMTKWIFKSKKEVDEICLKKYNDFKEKFKDHNVSIPKYAEIEKTKLYFCYQL
THFCEIKRLKPQIVECAIVLYNRFYLKEIILEYDPRILIFTCIILAIKLEGYGRLYRMND
FFNDIDINLDKVLEHENVVCSSLDFEINFLYTKECIFYLKSKFLNYINKYINKDNGIQNS
FENICNEIYVNTVQDCIKIIENFSITFTYTPAQIALYCFVNNIKINFNIVNADKFILEFI
TNNNQILFQKLKNKIDELHVRYKDHLDLRNTFDDENTTRQIGETLDMCIDIYEILKKKKS
SKKSKKKKLNTEDCASSEPSKRVDIK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattacccagaggacacttcgcacatgaccaaatggatcttcaaaagcaaaaaagag
gtagacgaaatatgcctaaaaaagtacaatgactttaaggagaaatttaaagatcacaat
gtcagtatcccgaaatatgcggaaattgaaaaaacgaagctgtacttctgttaccaattg
acgcacttttgcgaaataaaaagactcaagccgcaaatagtggaatgcgcaattgttttg
tacaacagattttacttaaaagaaattatattggaatatgacccacgtattttaattttc
acgtgcataatcttagcaataaaattggaaggatatggacgattatacagaatgaatgat
ttttttaacgacattgacataaatttggacaaagtacttgaacatgaaaatgtcgtttgt
tcatcgctagattttgaaattaattttttgtatacaaaagaatgtatcttttacttaaaa
agtaaattcctaaattatataaataaatatataaacaaggataacggaatacagaattcg
tttgaaaatatttgcaatgaaatttacgtcaatacagtacaggactgcataaaaattatc
gaaaatttttccattacctttacttatacacctgcacaaatagcattgtactgttttgtg
aataatataaaaattaatttcaacattgttaatgctgataagtttattctggaatttatt
accaacaataatcaaattctttttcaaaaattgaaaaacaaaattgatgaactccatgta
aggtataaggaccacctcgatttgaggaacacctttgacgatgaaaacacaactagacag
atcggcgaaacattagacatgtgtattgatatttacgaaattttaaaaaaaaaaaaaagt
agcaaaaaatcgaaaaaaaaaaagttaaacaccgaagattgcgcgtcaagtgagccctcc
aaaagggttgacataaagtag

DBGET integrated database retrieval system