KEGG   Plasmodium knowlesi: PKH_124560Help
Entry
PKH_124560        CDS       T01094                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PKH_124560
Peptidases [BR:pkn01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PKH_124560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
12:complement(join(1971044..1971139,1971274..1971333,1971445..1971498,1971638..1971718,1971830..1971897,1972076..1972148,1972326..1972394,1972533..1972586,1972829..1972960))
Genome map
AA seq 228 aa AA seqDB search
MLRNNIWVPIESNPESLYLYSCKLGQTKLIFQDIYGFDAELLDMIPQPVHAIILLYPLKE
GMINPNDEANGSTEQNVENIWFIKQIVPNSCGTVALFHLYGNLRNKFELDKDSLLANFFD
RVKDMTPEKRGKEFEVNKSIELLHHEFSGKASGTGDDIDVDTHFIVFVEIDGKLVELDGR
KDNPVIHCTTTPATFKYDTGNIIKKKFIEKCQGDNRFSALAVVSSDVV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctacggaacaatatttgggttcccatagagtccaacccggagtctctctacctctac
tcctgcaaacttggacagacaaagttgatctttcaggatatctatgggtttgatgcggaa
ctcctagatatgatcccgcaacccgtgcacgcaataatactgttgtaccccctgaaagaa
ggcatgattaatccaaatgatgaagcgaatggaagtactgaacagaatgttgagaatatt
tggttcataaaacagattgttccaaattcatgtggaacggtagccctttttcacctgtac
ggaaacttaagaaataaatttgagctagacaaggactctctcttggctaatttcttcgat
agggtgaaggacatgacgcccgaaaaacgagggaaggaatttgaagtgaacaagagtatc
gaactcctccatcacgaattttcaggaaaggcttctggcacgggggatgacatagacgtt
gatacccactttatcgtttttgtcgaaattgacgggaagctcgtcgagctggacggaagg
aaggataatcccgttattcattgcacgacgactccagccactttcaaatacgacacggga
aatataataaaaaaaaagttcatagaaaagtgccaaggtgacaacagattttcagcctta
gcagttgtatcaagtgatgttgtgtag

DBGET integrated database retrieval system