KEGG   Plasmodium knowlesi: PKH_125020Help
Entry
PKH_125020        CDS       T01094                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase (EC:1.3.99.5)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PKH_125020
    1.3.1.94  polyprenol reductase
     PKH_125020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:join(2147329..2147637,2147770..2147803,2148017..2148149,2148315..2148420,2148575..2148614,2148721..2148850,2148971..2149014,2149130..2149181,2149307..2149340)
Genome map
AA seq 293 aa AA seqDB search
MCGVSSLVQAMEEEGILKIICKVYYTVGCFVLLLSFHFKSINEWSLHGKNLYIKVEKGDA
DGEKWNSTFSKLRGKINHMTISKKHFSHFYVIGLVVNSALLICDLSQHAVSEQTVHHCIS
ITNVLLHVQLLRRLFEQLFIVRTTPKSVMHVFSYLLGVTFYLVTPYSLQNNDKREYTLVG
LLPVVVFLLGTLIQYDSHVRLAKLRPKGERKLDSPYKVPHGGLFYFVSCPHYFAEILIYL
SFLLLNWNFISLLSFTFVFLVLIKNGLQTHKWYLRTAREAYPKQRRAIFPYIL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcgtctcatcattggtacaagccatggaagaagaagggattctaaaaattatc
tgtaaagtttattataccgttggatgttttgtcctccttctttcttttcattttaaatca
ataaatgaatggtccctacatgggaagaatttgtacatcaaagttgagaagggtgatgcg
gatggggaaaaatggaactccacattttcaaagctgagggggaagataaaccacatgaca
atttcgaaaaagcatttctcccatttttatgtgatcggcctggttgtaaattctgcgttg
ctcatctgtgacctcagtcagcatgccgtgagtgaacaaaccgtccaccattgtatctcc
ataacgaacgttttgcttcatgttcagttgctcagaaggctatttgaacagctgttcatc
gtcaggacgacgccgaaatcggtcatgcatgtgttttcgtatcttttgggcgtaaccttc
taccttgtgacgccctattccctccagaataatgacaaaagggagtatacattggtaggg
ttactccctgttgttgtgtttctgttggggacattaattcagtatgattcccatgtccgc
ttggccaagcttcgtcccaaaggagaaaggaagttagacagcccctacaaagtgccgcac
gggggccttttctactttgtgagttgcccgcattattttgccgaaattttaatctacctg
tcctttttgctgctgaactggaattttatcagcttgcttagcttcaccttcgttttccta
gttctaataaaaaatggcttgcaaacgcacaagtggtacctcaggacagctcgagaagca
tatcccaaacaaagaagggctatttttccgtatatcttatga

DBGET integrated database retrieval system