KEGG   Plasmodium knowlesi: PKH_125460Help
Entry
PKH_125460        CDS       T01094                                 

Definition
protein phosphatase 2b regulatory subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pkn  Plasmodium knowlesi
Brite
Protein phosphatases and associated proteins [BR:pkn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PKH_125460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
12:join(2359037..2359041,2359282..2359450,2359683..2359767,2359964..2360109,2360201..2360281,2360429..2360476)
Genome map
AA seq 177 aa AA seqDB search
MGNTQAILSEKDQKDLLQAANFSEVDIKKMYKRFVELDTNKNGQLDPNELFDVPEISDNP
LVKRVISIFDSNSDGKVSFVEFLVGITKLASSTDDFQKKKFAFDIYDINKDGMISNGELF
TVMKMMVGNNLNDIQLQQLVDRTIIQADKDGDGMISFEEFKDMISHMDVGNKLKLDL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacacaagcaatattatcagagaaagaccaaaaggatttgttacaagcagct
aattttagcgaagtggatataaaaaaaatgtacaaaagatttgttgaacttgacacaaat
aaaaatggacaactagatccaaatgaattatttgacgttcctgaaataagcgataaccca
ctagttaaaagagtcatatcaatctttgattccaactcggatggaaaagtttcttttgtg
gaattcttagttggcataaccaagctagcctcgagcacggatgattttcagaagaagaaa
tttgcctttgatatatacgacataaataaggatggaatgatatccaacggggagctgttt
accgttatgaagatgatggtagggaataacctaaatgatatacagttgcagcaattggtc
gaccgaaccattatacaggccgataaggatggagatgggatgatttccttcgaagaattt
aaagatatgatatcccacatggacgttgggaacaaattgaagctagatctgtag

DBGET integrated database retrieval system