KEGG   Plasmodium knowlesi: PKH_125860Help
Entry
PKH_125860        CDS       T01094                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pkn  Plasmodium knowlesi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PKH_125860
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PKH_125860
Enzymes [BR:pkn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PKH_125860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
12:join(2538694..2538981,2539211..2539381,2539654..2539875)
Genome map
AA seq 226 aa AA seqDB search
MKFFLFLALLFVLLILQRNHANMFSFFKKITVSKEELRPSIYDYHVKKLDGTTVPMSTYK
NKVLLIVNSASKCGLTRKHVDQLNQLHDRLNEQGLEILAFPTSQFLNQEFPNTCDISSFN
DKNKIKYNFFAPIEVNGENTHELFKFLKANCDSMHDKNGQLENIGWNFGKFLVNRSGNVV
SYFSPRTYPLEIEKNITDLLEKKTKTELSVNQDGQIESSLSSTSSS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcttcttatttttagcgctactctttgtactgctaattttacaaagaaaccat
gccaacatgtttagcttcttcaaaaaaataactgtttcgaaggaggaattgcgtccctcc
atttatgactatcatgtgaagaagctggatggaacaactgtgccaatgtctacatacaaa
aacaaggtcttgctgattgttaactcggcttccaagtgtggcttaacgcgaaagcatgtg
gatcagcttaaccagctgcacgatcgattgaacgagcagggattagagattttggccttc
ccgactagccagttcctaaaccaagagttccccaacacgtgcgacatttcctcatttaat
gataaaaacaaaatcaaatataacttcttcgcccctattgaagtcaatggagaaaacact
catgagctgtttaaatttctgaaggccaactgcgactcgatgcacgacaagaatggacaa
ctagaaaacatcggctggaactttggaaaatttttagttaatagaagcggaaacgtagtc
agctatttttccccaagaacatatccccttgaaattgagaagaacataactgatttactg
gaaaaaaaaacaaaaacagagttaagtgtaaatcaagatggacaaatagagtcctcttta
tcctccacctcgtcctcgtga

DBGET integrated database retrieval system