KEGG   Plasmodium knowlesi: PKH_126090Help
Entry
PKH_126090        CDS       T01094                                 

Definition
serine/threonine kinase-1
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PKH_126090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
12:2632719..2635379
Genome map
AA seq 886 aa AA seqDB search
MIQENNKDCNDKYSSKYREYNYYRNYISDIKGKYMGFGNMQRDSPNAGRYFNDPQRNNNY
YYYNREGNLHNSAYRNSYRNSYRNSIRNSIRNSNRNSYKDLHKNLYENSYQCSYHNGYHD
SHNHLYNSGFDNAYRNEYSNEYNNAYGNSYGSGLKLLKGKRIRSFNSSSNSSRKGKLFKK
FKNYDVDENMIRAYKNGRKRSYSSMREIDDHEQRHHKVYLESKYDHEEYQNNYIKGFNVS
RKRNYYSYKKKLYNSDKRNYDTHFGQGNIFYNNEYYLFNDGSMLKRKKMYYGNKNSFRTN
SRSYNGHLDRMNNRRKDSHRNGKCKATAAHPKETGSWGRGPSASSATSADSTVRECNYKD
KDGKSNKSFKLKNSDTTRDDGTGKSNMRDEIMGNRRNLAACIDKEKGSHQSPRKYTRGVR
KRKKAPDSYSGTRSGRRSRRRSTQRRRRRKDSLSSNDGTGTSSFSQRGSSYSSVENKKKH
YSDRYSSESDEYTPSDESTDDISSRKKHNHKRNRTKISDMDDNSYRKKKKKKKENYDSDD
EIVHFSWKKGMVLNNCYVVIRKMGEGTFGRVLLCQHMDTKKYYAVKVVRNIKKYTKSAKI
EADILKKIQNDDFKNNNIVKYHGRFMYYDHMCLVFEPLGPSLYEIITKNNYNGFHLEDIK
LYCIEMLKALNYLRKICLTHTDLKPENILLDDPYFEKTLVSVRRATDGKRVDIYRTKSTG
IKLIDFGCATFKDGYHGSIINTRQYRAPEVILNLGWDVSSDMWSFGCVLAEMYTGDLLFR
THEHLEHLALMEAIIQPIPKKMISDAIRTNGAKYINRDHLRLAWPENASSFESIKYVKRC
LPLYKLIRNDLFCDFLYSVLQIDPALRSSPAELLKHRFLQESYEYY
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgatccaagagaacaacaaggactgtaatgacaagtacagcagtaaatatagagaatat
aattattacaggaattatataagcgatataaaaggcaagtatatgggtttcggaaatatg
caaagggatagcccgaacgcaggcaggtattttaatgaccctcaaaggaacaacaattac
tactactacaaccgggagggaaacctgcacaacagcgcatacagaaattcttacagaaat
tcgtacagaaattcgatcagaaactccatcagaaattcgaacagaaattcatacaaagat
ttgcacaaaaatttgtatgaaaattcgtaccaatgctcgtaccataacgggtaccatgat
tcgcacaaccacctgtacaatagcggcttcgacaatgcctacaggaacgagtacagcaac
gaatacaacaatgcgtatggcaattcctacgggagcggtttgaagctgcttaaggggaaa
aggatcaggagtttcaacagcagtagcaactccagtcggaaaggaaagctctttaagaaa
tttaaaaactatgatgtggacgaaaatatgatcagagcgtataaaaatgggaggaaacgc
agctactcgtccatgagggaaatagatgatcatgaacagagacaccataaggtgtatcta
gaatccaagtacgaccacgaggagtatcaaaataattacataaaaggatttaatgtgagc
agaaaaagaaactactattcttataagaaaaaattgtacaatagtgataaaagaaattat
gacacccactttggacagggaaatatcttttacaataatgaatattacttatttaacgac
ggctctatgttgaagaggaaaaaaatgtattatggcaataaaaatagcttcagaacaaat
tctaggagctataatgggcacctagacagaatgaataatagaaggaaagattcccatcga
aatgggaagtgtaaagcgacggctgcgcatccgaaggagacaggaagttggggaagggga
ccaagtgcatctagtgcaacgagtgcagatagcacggtgagagaatgcaactataaagac
aaggatggcaaatctaataaatcattcaagttaaaaaatagcgatacgacacgagatgat
ggtacagggaaatcaaatatgagggatgaaattatgggaaataggaggaatctcgccgcg
tgcattgataaggaaaaaggatcacatcagtcacctcgtaagtatactcgaggtgtaagg
aaaagaaaaaaggctcccgacagttatagtggtacgagaagtggacgtcggagcaggcga
aggagcacacaacgaagaaggcgcagaaaagatagtctcagtagcaatgacggaacaggc
acaagttctttttcacaaagagggagcagctactcctcagttgaaaataaaaaaaaacac
tattcggataggtacagtagtgagtccgacgagtataccccgtcggatgaatcaacggat
gatatatcgtcgaggaaaaaacacaaccacaaaagaaacagaacgaaaatttcagatatg
gatgataatagctataggaagaaaaaaaaaaagaaaaaagaaaattacgactcagatgac
gaaattgtacacttcagttggaaaaagggaatggtcttaaacaactgttacgtggtgata
cgaaaaatgggggagggaaccttcggaagagttcttctctgtcagcacatggacacaaag
aagtattacgcggtgaaggtagtacgaaatattaagaagtatacaaaatctgcaaagata
gaagcagatattttgaagaaaattcaaaatgatgattttaaaaataataatattgtaaaa
taccatggaaggtttatgtactacgatcacatgtgtctggttttcgaacccctgggtcca
tctctctacgaaattatcaccaaaaataactacaacgggtttcatttggaggatattaag
ctttattgcattgaaatgttgaaagcattgaattatctccgcaaaatatgtttaacgcac
accgatttaaagccagaaaatattttgctagacgacccctattttgagaaaaccttagtg
agtgttagaagagctacagatggaaagagggttgatatttatagaactaaatctacggga
atcaaattgatagattttggttgtgccacatttaaggatggataccatggatctattata
aacacaagacaatatcgtgctccggaagttatcttaaatttaggatgggatgtgtcaagt
gatatgtggagttttggttgtgtattggctgaaatgtacacaggggatcttctctttaga
acccatgagcatttagagcacttagctttgatggaagctatcattcagccaattcccaaa
aaaatgataagcgatgcgatcagaacaaatggggccaaatatataaatagggatcatcta
agattggcttggccagaaaatgcttccagttttgagtccattaagtacgtcaagaggtgc
cttccgctgtacaaacttataaggaatgatttattttgcgactttttgtatagcgtactg
cagatcgaccccgcgttgaggtcatcccccgccgagctgttgaagcacaggtttctgcag
gagagttatgaatactactag

DBGET integrated database retrieval system