KEGG   Plasmodium knowlesi: PKH_126610Help
Entry
PKH_126610        CDS       T01094                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pkn  Plasmodium knowlesi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PKH_126610
Enzymes [BR:pkn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PKH_126610
Exosome [BR:pkn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PKH_126610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
12:complement(join(2866289..2866641,2866787..2867051,2867259..2867600,2867729..2867965,2868379..2868426,2868587..2868703))
Genome map
AA seq 453 aa AA seqDB search
MIKIDGIILLYLSVLNLVCCLNSNLSKSAYILYTPKSTKRYKAPFRRWNSPQNNNNENLS
NLTKEQKSTEDVYNENVARQSNLKNFAKDINDNVYIETNRRERRIKRNKHLRSLYSNNSI
RMSNFIYPMFIHEEDTPKKTTQLDGIYTYSIDGIMKEIEECLQLNIHHFMFFPVVKEENK
TTYCSECYNESSFFCNAINKIKQKFKNEVVIYVDVALDPYNIYGHDGIYDEQQGEILNDV
TVHTLVKQSLCLAKCGADVVCPSDSMDNRIEQIRKNLDFHNFRNVLILSYTCKYSSCLYK
PFRSILNSNIHKNVIKNKQSYQHDFNTYYDLNHVEKHIAEGADILMVKPSLFYLDVISRI
RSRMAKHAQVPLAVYNVSGEYMMIKNYVKHLNAHINYENEILTELFKSYLRSGANIIISY
FAKQFGLYLKNLYNRNVDKEDDLNSNFNIELTL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatagatggaataattttactttacctttctgtgctcaatttggtgtgttgt
cttaatagcaacttgagtaaaagcgcctacatcttgtacactccgaagtcgacgaagagg
tacaaggctcccttcagaagatggaatagcccacagaacaataacaatgagaatttgagc
aatttaactaaggagcaaaaatcaactgaagatgtgtacaacgaaaatgtggcaagacag
tccaacctaaaaaattttgcaaaagatataaacgacaatgtctacatcgaaacgaatagg
agggagaggaggataaagaggaataagcacttgcgctccttatacagtaacaatagcatc
cggatgtcaaactttatttatccgatgttcattcatgaagaggacactccaaagaagaca
actcagctggatggaatttacacctatagcatagatggaatcatgaaagaaatcgaagaa
tgcttacaactaaatattcaccactttatgttttttcccgttgtgaaggaagaaaataaa
acaacatactgctcagaatgttataatgaaagtagtttcttctgtaacgcgataaataaa
ataaaacagaaatttaaaaatgaagttgtgatttacgttgacgtggctctggatccatac
aacatatacgggcatgatggaatatatgacgaacaacagggggaaatactcaacgacgtt
accgtgcacacgctggtgaagcagtctctatgcctagccaagtgcggcgccgacgtagtt
tgccctagcgattccatggacaacagaattgaacaaattaggaaaaacctagattttcac
aacttcagaaatgtactaatattgtcctacacgtgcaaatattcgtcatgcctgtataag
ccatttagatccatcctgaattccaatattcacaaaaacgtgattaaaaataagcagtcc
tatcagcacgactttaatacgtactacgacctcaaccatgtggagaaacacatcgccgaa
ggggccgatatcctcatggtcaaaccgtcgttattttacctagacgtgatcagtcgcatc
agaagcagaatggccaaacatgcccaagtcccattggcagtttacaacgtttctggtgaa
tacatgatgatcaaaaattacgtcaaacatttgaatgcacacataaattatgaaaatgaa
attttaacggagctatttaaaagttacctaagatccggggcaaatataattatcagctat
tttgcaaagcagtttggtttgtacctcaaaaatctctataaccgtaatgttgacaaagaa
gacgatttgaatagcaattttaatattgaattgacgctataa

DBGET integrated database retrieval system