KEGG   Plasmodium knowlesi: PKH_131090Help
Entry
PKH_131090        CDS       T01094                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pkn  Plasmodium knowlesi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PKH_131090
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PKH_131090
Enzymes [BR:pkn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PKH_131090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
13:complement(join(510575..510718,510990..511160,511399..511686))
Genome map
AA seq 200 aa AA seqDB search
MKFFLFLALLFVLLILQRNPANMFSFFKKITVSKGELRPSIYDYHVKKLDGTTVPMSTYK
NKVLLIVNSASKCGLTRKHVDQLNQLHDRLNEQGLEILAFPTSQFLNQEFPNTCDISSFN
DKNKIKYNFFAPIEVNGENTHELFKFLKANCDSMHDKNGQLENIGWNFGKFLVNRSGNVV
SYFSPRTYPLEIEKNITDLL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcttcttatttttagcgttactcttcgtactgctaattttacaaagaaaccct
gccaacatgtttagcttcttcaaaaaaataactgtttcgaagggggaattgcgtccctcc
atttatgactatcatgtgaagaagctggatggaacaactgtgccaatgtctacatacaaa
aacaaggttttgctgattgttaactcggcttccaagtgtggcttaacgcgaaagcatgtg
gatcagcttaaccagctacacgatcgattgaacgagcagggattagagattttggccttc
ccgactagccagttcctaaaccaagagttccccaacacgtgcgacatttcctcatttaat
gataaaaacaaaatcaaatataacttcttcgcccctattgaagtcaatggagaaaacact
catgagctgtttaaatttctgaaggccaactgcgactcgatgcacgacaagaatggacaa
ctagaaaacatcggctggaactttggaaaatttttagttaatagaagcggaaacgtagtc
agctatttttccccaagaacatatccccttgaaattgagaagaacataactgatttactg
taa

DBGET integrated database retrieval system