KEGG   Plasmodium knowlesi: PKH_131265Help
Entry
PKH_131265        CDS       T01094                                 

Definition
cGMP-dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     PKH_131265
Protein kinases [BR:pkn01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   PKH_131265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:join(599399..599403,599557..599626,599777..599951,600142..600572,600798..602654)
Genome map
AA seq 845 aa AA seqDB search
MINERNKKKAIFSNDEFSGEDTLMEEHLQLREKLSEDIEMIKSSLKNNLVCSTLNDNEIL
TLSNYMQFFVFKSGDLVIKQGEKGSYFFIINSGKFDVYVNDKKVKSMGKGSSFGEAALIH
NTQRSATIMAETDGTLWGVQRSTFRATLKQLSNRNFNENRSFIDSVSVFDMLTEAQKNMI
TNACVIQTFKPGEIIVKQGDYGDVLYILKEGKATVFINDKEIRVLNKGSYFGERALLYDE
PRSATIIAKEHTSCASICRKLLNIVLGNLQVVLFRNIMTEALQQSEIFKQFSAEQLNDLA
DTAIVRDYPANYHILHKDKVKSVKYIIVLEGKVELFLDDESIGILTRGKSFGDQYVLNQK
QKFRHTIKSLEICKIALITESCLADCLGDNNIDASIDHNNKKSIIKKMYIFRYLSEKQCN
LLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEVTKNGKRLRTLGKNDYFGERALLY
DEPRTASIISKATNVECWFVDKSVFLQIIQGPMLTHLEERIKMQDTKVEMDELETERIIG
RGTFGTVKLVHHKPTQIRYALKCVSKRSIINLNQQNNIKLEREITAENDHPFIIRLVRTF
KDSKCFYFLTELVTGGELYDAIRKLGLLSKPQAQFYLGSIILAIEYLHERNIVYRDLKPE
NILLDKQGYVKLIDFGCAKKIQGRAYTLVGTPHYMAPEVILGKGYGCTVDIWALGVCLYE
FICGPLPFGNDQEDQLEIFRDILTGHLTFPEYVTDQDSIKLMKRLLCRLPQGRIGCSING
FKDIKDHAFFSNFNWDKLAGRLLEPPLVSKGETYAEDIDIKQIEEEDALSEGEPLDGDDS
WDVDF
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgaacggaataagaagaaggcaattttttcaaatgacgaattttcgggggaa
gacactttgatggaggaacacctccaactgagggaaaagctctcagaagacattgagatg
ataaagtcctcgctcaaaaataacctcgtttgtagcacgttgaacgacaatgaaatattg
accctgtctaattacatgcagttttttgttttcaagagtggagacctagtgataaaacag
ggggagaaaggatcctacttcttcattataaacagcggcaaattcgacgtgtatgtaaat
gacaagaaggtgaagagcatggggaagggaagttccttcggcgaagcagccctaattcac
aacactcagagaagcgcaacgattatggctgagacggatgggacgctgtggggtgtacag
agaagtaccttcagggcaacactaaaacaactgtctaatagaaattttaacgaaaacaga
agtttcattgactcagtgtctgtattcgacatgttaactgaagcacagaagaatatgata
acgaatgcatgcgttattcaaacttttaaaccgggagagataattgtgaagcagggcgat
tatggtgatgtgttgtatatattgaaggaaggtaaagccacagtttttattaacgataaa
gaaataagagtacttaacaaaggatcttacttcggagaacgagctctgttgtatgacgaa
ccgagaagtgccaccatcatagcgaaagaacacacatcatgcgcatcgatatgtagaaag
ttgttaaacatagtgttgggtaatttacaagttgtcctattcaggaacatcatgacggag
gcgttacaacagagcgaaatttttaagcaattcagtgcagagcagctaaacgatttagca
gacacagccattgttagggattacccagccaattatcacattcttcataaggataaggtt
aagtcggttaagtatattatcgtattagaagggaaggtggagttatttctggatgatgaa
tctataggcatacttacaagaggaaaatccttcggggatcaatacgttttgaaccagaag
caaaaattcagacatacaataaaatctcttgaaatttgcaaaattgctctgatcacagaa
tcttgtttggcggattgtctaggagacaacaacatagatgcatcgatagaccataacaac
aaaaaaagcatcatcaagaagatgtacatttttaggtacctaagtgagaagcaatgcaat
ttacttatcgaagcctttaggactaccaggtatgaagagggggattatataattcaagaa
ggagaagtgggttcaaggttctatatcataaagaatggggaagtagaagtaacaaaaaat
ggaaagagactacggacattggggaaaaatgattactttggagaaagggctctcctatat
gatgaacccagaactgcatctatcatcagtaaggcaaccaatgttgagtgctggttcgtg
gataaaagtgtgtttttgcaaattattcagggacccatgttaactcacttggaggagcga
attaagatgcaggacactaaagtggagatggacgaattggaaactgaaagaattataggt
agaggtacattcggaaccgttaagttagtgcaccacaaaccgacacaaattagatatgct
ctaaaatgtgtcagcaaaagaagtatcatcaatctaaatcaacaaaacaatattaaattg
gagagggaaattactgcagaaaatgaccacccattcataattagacttgtgaggacattt
aaagattcgaagtgtttttattttttaacggagctagttactggtggggagttgtatgat
gccattagaaaattaggattactctccaaacctcaggcacaattttacttggggtccata
attctagccatagaatatctacacgagagaaatattgtgtatcgagatttgaagccagaa
aatattcttctagacaaacagggctatgtaaaactgatagattttggttgtgcgaagaaa
attcaggggagggcctacacacttgttggtactcctcactacatggcaccggaagttatt
ttggggaaaggatatgggtgcactgtggatatatgggcactaggagtatgcctgtacgaa
tttatttgtggtcccctcccatttggtaatgaccaagaagatcaactggaaatattcagg
gatattctaacagggcatctaacatttcccgagtatgtgaccgatcaggatagcataaaa
ttgatgaagcgattgttgtgtagattacctcagggacgaattggatgttccataaacggg
ttcaaggatattaaggatcatgccttttttagcaatttcaattgggataagttggcgggg
cgtttgctagagcccccgctcgtgtccaaaggagagacatatgctgaggatattgacatt
aagcagatcgaggaggaggacgcgctgtccgagggcgaacctctcgacggggatgacagc
tgggatgtggacttttga

DBGET integrated database retrieval system