KEGG   Plasmodium knowlesi: PKH_131660Help
Entry
PKH_131660        CDS       T01094                                 

Definition
protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PKH_131660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:join(803829..803927,804199..804352,804626..805047)
Genome map
AA seq 224 aa AA seqDB search
MYTLAEKNHKSLIDSLKDRGIIDDDDVYETMLQVDRGKYIKEKPYVDMPVYISHGVTISS
PHMHALSLKRLMDVLKPGSRAIDVGSGSGYITVCMAMRTKVLENKDSFVIGLERVKDVAN
FSIENIRRDKPELLHLDNFKIIHKNIYQVSEQEKEQLGLFDAIHVGASASELPEILIDLL
AENGKLIIPLDEGYTQVLYEITKINGKIVKDRLFEVCFVTLKKN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtacacccttgcagaaaagaaccacaagagtttaattgacagtcttaaggacagaggc
ataattgacgatgacgacgtgtacgaaacgatgctacaggtggacagggggaagtacata
aaggagaaaccctatgtggacatgcccgtctacatcagccacggggtgactatatcctcc
cctcacatgcacgccctgtctctgaaacgcctaatggatgtactgaagccgggatcccgg
gccattgacgtgggctccgggtcgggctacataaccgtgtgcatggccatgaggacgaag
gtactggagaacaaagactccttcgtgataggactcgagagggtaaaagacgtggcgaac
ttctccatcgaaaacataagaagagacaaaccagagttattgcatttggataactttaaa
attattcacaaaaatatatatcaagtgagtgagcaggagaaggaacagttaggattgttc
gatgccattcatgtaggagcatctgcaagtgagttgccagaaattttaatcgatctgttg
gcggagaatgggaagttgatcatcccactggatgaggggtatacgcaggttttgtacgaa
attacgaaaatcaatgggaaaatagtaaaagataggctcttcgaagtttgcttcgtaact
ttgaaaaaaaattag

DBGET integrated database retrieval system