KEGG   Plasmodium knowlesi: PKH_131880Help
Entry
PKH_131880        CDS       T01094                                 

Definition
mitogen-activated protein kinase 1, MAP-kinase 1
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PKH_131880
Protein kinases [BR:pkn01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PKH_131880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
13:937698..939776
Genome map
AA seq 692 aa AA seqDB search
MKKEGQQSKDEQVDECVLKKYDIVRKIGKGAYGIVYKAKCKRNRKIVAVKKIFGAFQNST
DAQRTFREIMFLYQLNGHDNIITLMDVIKAKNDNDIYLVFDYMETDLHEVIKADLLEEIH
KRYIIYQLLRALKYIHSGMLLHRDIKPSNILLNSECHIKVGDFGLARSISTELSENKIPV
LTDYVATRWYRAPEILLGSTNYTEGVDMWSLGCIMAELLLGRPLFRGNSTMNQLEKIIQL
IGKPTKKDMEDIKSPFTDTIISSFVDIKRKNFSDIFSKASVEALDLLKQLLQFNPTKRIS
AENALKHKYVEQFHSIIDEPVCRHIITIPVDDSTKYRVSFYRNIVYYDIMRRKKYHPGGR
SFEGSGKSAGQVADHVREPADTPLHQNITKDESPGKPRQQDQQKEETIPSSSSTNKGNMQ
STTPPQMEEDGTRITSHRGKCAPKIRSTQSIHDEKSTKRQPKKSDKRERAAERRNGNATA
HPNEKHYYEVPGEGKTGNAHDGYLYKEMRNAQGESREIRTKTSNGDATRKLHEWSNERGQ
VVASATSVNVTRRNDDKGGSMGERRVDAKTANVIRGERMVRIVNRTTGRMVRSHFVNAAD
VEAVKHDHPRIQSITPQKKETVKWRKRGGDAGAMAKRVDFCGAHCHDVTGKRSSPKKKKK
KKKKVHRNNVLPSYTTYRQNCSFAFSLFTFPF
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggagggacaacaaagcaaagacgagcaggtagacgaatgtgtactcaagaaa
tacgacatcgtgagaaaaataggaaaaggagcatacgggatagtgtacaaagccaagtgt
aaaaggaaccgaaaaattgtcgcggtgaaaaaaatttttggtgctttccaaaactcaaca
gatgcgcaaaggacattcagagaaattatgttcctctatcaattgaatggacatgataat
atcatcaccctcatggatgtgataaaagcaaagaatgacaacgacatttacttggtgttc
gattatatggagactgatttacacgaagttataaaggcagatctcttggaagaaattcat
aaaaggtatattatttatcagctattgagagcattaaagtatatccactcaggaatgctt
ctccatcgtgatataaaaccttcaaacattttattgaactccgaatgccatataaaagtt
ggagactttggattggcgagaagtatatctacagaactcagtgaaaataaaattccagtc
ttaactgattacgttgctacaaggtggtacagagccccggaaattcttttaggaagtacc
aactacactgaaggggtggatatgtggtctcttggatgcatcatggcggagctcctactt
ggtagacctctctttaggggaaactccacaatgaaccaacttgaaaaaattattcaactt
attggaaagccaacgaaaaaagacatggaagatataaaatctcctttcacagataccatt
atttcttctttcgttgatataaagcgaaagaatttttcagacattttttccaaggcttcc
gtggaggcacttgaccttctcaaacaacttctgcaattcaatcccaccaaacggatcagc
gcagagaacgctctaaaacacaagtacgttgagcaattccactccattattgatgaaccc
gtgtgcagacacatcattaccatcccggtggatgatagtaccaagtaccgagtgagcttc
tacagaaatattgtctactacgacattatgcgcaggaagaagtatcaccctggtgggcgc
agttttgaggggagcggaaaatccgctggtcaggtggcggaccatgtcagagaaccggca
gatactcctctccatcagaatatcaccaaggacgagtcacctggaaaaccccgtcaacag
gatcaacagaaggaggagacgattccctcgtcttctagtaccaacaaggggaatatgcag
tcaaccacaccgccccaaatggaggaagacgggacgaggataacttcacacagaggaaaa
tgtgcccccaaaattaggagcacacaaagtatacatgatgagaaatccaccaaacggcaa
cctaagaagagcgacaaaagagagcgcgccgcggagaggcgcaacgggaatgcaactgca
catccgaatgagaagcattactacgaagtacctggtgaaggtaaaactggcaatgcacac
gatggttatctctacaaagagatgagaaacgcgcaaggggaaagtagggaaattaggacc
aagacttctaacggagatgcaacaaggaagctccacgaatggtccaatgagaggggacaa
gtggttgcctcagcaacttccgtcaatgtaaccagaaggaacgatgataagggcgggagt
atgggggagagaagggtggacgccaaaactgcgaacgtaatcaggggagagcgcatggtc
cgcattgtaaacagaactacaggcagaatggtgaggagccactttgtgaacgcggctgac
gtggaggcggtaaaacatgaccatcctagaatacaatcaattactccccagaagaaggaa
acggtcaagtggaggaaaagagggggtgacgcgggtgccatggcaaaacgtgttgacttt
tgcggggcccactgccacgacgtcacaggtaagagaagctctccaaaaaaaaaaaaaaaa
aaaaaaaaaaaagtccatcgaaacaatgtccttccctcatatacaacatataggcaaaat
tgttctttcgccttttcacttttcacttttcccttttaa

DBGET integrated database retrieval system