KEGG   Plasmodium knowlesi: PKH_133280Help
Entry
PKH_133280        CDS       T01094                                 

Definition
serine/threonine protein phosphatase (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pkn  Plasmodium knowlesi
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PKH_133280
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PKH_133280
Protein phosphatases and associated proteins [BR:pkn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PKH_133280
Transcription machinery [BR:pkn03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PKH_133280
Spliceosome [BR:pkn03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PKH_133280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
13:complement(join(1584296..1584334,1584483..1584617,1584784..1584935,1585369..1585692,1586031..1586295))
Genome map
AA seq 304 aa AA seqDB search
MALEIDIDNVISKLIEVRGTRPGKNVNLTENEIKILCLSSREIFLNQPILLELEAPIKIC
GDIHGQFYDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR
GNHECASINRIYGFYDECKRRYSVKLWKTFIDCFNCLPVAAIIDEKIFCMHGGLSPELNN
MEQIRKITRPTDVPDNGLLCDLLWSDPEKEINGWGENDRGVSFTFGQDVVHNFLRKHELD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKK
KAAN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcattagaaatagatatagataatgtaatatcaaagctaatagaagttcgaggcacc
agaccagggaaaaatgttaacttgacagaaaatgagataaaaatattatgcctttccagc
agagaaatttttcttaaccaacctatattactggagctcgaggcacccataaaaatatgt
ggagacattcacggccagttttatgacttgttaaggctcttcgagtatggcggcttcccg
ccggatgccaattatttatttttgggagattacgtggatagaggtaaacaaagcctagaa
accatttgcttactactagcgtacaaaataaaatatcccgagaacttttttctactaaga
ggaaatcacgagtgtgcctccataaacagaatatacggattttacgatgaatgtaaacga
agatacagtgtaaaattgtggaaaacatttattgattgcttcaactgtctccccgttgcg
gcaataattgacgaaaaaattttttgtatgcatggcggactatcgcctgaattaaataat
atggaacagattaggaagataacgaggccaacggatgtccccgacaatggcctcctatgt
gatttattatggtctgacccggagaaggaaataaacgggtggggagaaaacgatcgagga
gtttccttcacttttggccaagatgtagttcacaattttttaaggaaacatgaattggac
ttgatatgcagagcacatcaggtggtggaagatggttacgaatttttcgccaaaagacag
ctagttacgttgttttctgctcccaactattgcggagaatttgataatgccggtgccatg
atgagtgtggacgaaacattgatgtgttcatttcaaattttaaagccagtcgaaaaaaaa
aaggctgctaactga

DBGET integrated database retrieval system