KEGG   Plasmodium knowlesi: PKH_134280Help
Entry
PKH_134280        CDS       T01094                                 

Definition
Cytochrome C
Orthology
K08738  
cytochrome c
Organism
pkn  Plasmodium knowlesi
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PKH_134280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
13:join(2069385..2069490,2069701..2069945)
Genome map
AA seq 116 aa AA seqDB search
MSVRPEPKVDVPKGDYQKGAKLFKAKCAQCHTINKGGAVKQGPNLHGFYGRKSGEADFPY
SDANKNSGIVWSDKHLYEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaaggccagaacctaaagtagacgttcctaagggtgactaccaaaagggtgcc
aaactttttaaggcgaagtgtgcgcaatgccacacgataaataaaggtggagcggtaaag
cagggccctaacctacacgggttctatggaagaaaatctggagaagcggatttcccatat
tcagatgcaaataagaactcaggtattgtctggtcggataagcatttgtatgaatatcta
ctgaaccctaagttgtacataccaggaacgaaaatgatttttgctggaattaaaaaggag
aaggaaagagcagatttgattgagtatttgaagaaggcttcttcagaatga

DBGET integrated database retrieval system