KEGG   Plasmodium knowlesi: PKH_134280Help
Entry
PKH_134280        CDS       T01094                                 

Definition
(RefSeq) Cytochrome C
  KO
K08738  cytochrome c
Organism
pkn  Plasmodium knowlesi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Motif
Other DBs
NCBI-GeneID: 7322943
NCBI-ProteinID: XP_002260951
UniProt: A0A1A7VD07 B3LAW9
Position
13:join(2069385..2069490,2069701..2069945)
Genome map
AA seq 116 aa AA seqDB search
MSVRPEPKVDVPKGDYQKGAKLFKAKCAQCHTINKGGAVKQGPNLHGFYGRKSGEADFPY
SDANKNSGIVWSDKHLYEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaaggccagaacctaaagtagacgttcctaagggtgactaccaaaagggtgcc
aaactttttaaggcgaagtgtgcgcaatgccacacgataaataaaggtggagcggtaaag
cagggccctaacctacacgggttctatggaagaaaatctggagaagcggatttcccatat
tcagatgcaaataagaactcaggtattgtctggtcggataagcatttgtatgaatatcta
ctgaaccctaagttgtacataccaggaacgaaaatgatttttgctggaattaaaaaggag
aaggaaagagcagatttgattgagtatttgaagaaggcttcttcagaatga

DBGET integrated database retrieval system