KEGG   Plasmodium knowlesi: PKH_134520Help
Entry
PKH_134520        CDS       T01094                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pkn  Plasmodium knowlesi
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pkn00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
13:complement(2150335..2151660)
Genome map
AA seq 441 aa AA seqDB search
MESISRTYENIKNDKNNLSNAENENNGNFKAPPNGTVCCPEDLKMYSTIQLNQEIEISKN
PFPLHEINKKNDIPLCAQEFSDLTDPLYIKKICLEKVPEWNHFTEDNLRVKQILSGLTNQ
LFEVGLKEETANNYNSIRTRVLFRIYGKHVDELYNTISEFEVYKTMSKYKIAPQLLNTFN
GGRIEEWLYGDPLRIDDLKNPTILIGIANVLGKFHTLSRKRHLPEHWDRTPCIFKMMEKW
KNQLFKYKNIEKYNCDIHKYIKESDKFIKFMKVYSKSDNLANTIVFCHNDLQENNIINTN
KCLRLIDFEYSGFNFLATDIANFFIETSIDYSVSSYPFFEIDKKKYISYENRKLFITAYL
SNYLDKSLVVPTPKLIDEILEAVEVQALGAHLLWGFWSIIRGYQTKSYNEFDFFLYAEQR
LKMYDDQKEYLISNNIIKGYD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtatcagcaggacatacgaaaatattaaaaatgataaaaacaatttatcaaat
gctgaaaacgagaacaatggaaatttcaaagcgccccctaatggaaccgtctgttgtcct
gaagacttaaaaatgtatagcactattcagctaaatcaggaaatagaaatatccaagaat
ccatttcctttacacgaaattaataaaaagaacgacatacccttgtgtgcccaagaattc
tcggacctaacggatcctttatatattaaaaaaatatgcctggaaaaagtaccagagtgg
aatcattttaccgaagataatttaagggttaagcagatactaagtggactaaccaatcag
ttatttgaggtgggcctaaaagaagaaacggcaaacaattataattccataaggacacgt
gttttatttaggatctatggaaaacacgttgacgagttgtacaatacaatctctgaattt
gaagtgtacaaaactatgagcaaatataaaatagctccccagttgctaaacacatttaat
ggggggcgaatagaggaatggctttatggagatcccctccgaattgatgatttaaagaac
ccaaccatattaattggtattgcaaatgtgttgggtaaatttcataccctcagtaggaaa
cgtcatttacctgaacactgggatagaacaccgtgtatctttaaaatgatggaaaaatgg
aaaaatcagctcttcaagtataaaaatatagaaaagtataattgtgatattcataagtat
atcaaggaatctgacaagtttattaaatttatgaaggtgtattccaagtcagacaattta
gccaatactatcgttttttgccataatgatctacaagaaaacaacattattaataccaat
aagtgtttacgcctaattgattttgaatactctggctttaattttctcgcaacagatata
gctaactttttcatcgaaacatccatagattattctgtaagctcctatcccttttttgaa
attgataagaaaaaatacatttcctatgaaaataggaaattgtttatcacagcatattta
tcaaattatctggacaaatctcttgtcgtaccaacccccaaattaattgatgaaatatta
gaggcagtggaggtacaagccttgggtgcccatttgttatggggattttggtcaatcatt
agagggtatcaaacaaaaagttacaacgaatttgattttttcctatatgcagaacagagg
cttaaaatgtatgatgaccaaaaggagtatttaatttcaaacaacattattaaaggttac
gattag

DBGET integrated database retrieval system