KEGG   Plasmodium knowlesi: PKH_141090Help
Entry
PKH_141090        CDS       T01094                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pkn  Plasmodium knowlesi
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pkn00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
14:complement(496392..496856)
Genome map
AA seq 154 aa AA seqDB search
MNLARNKKNNLIDDELPNDFVLPEGDKVKGEKLFKKHCKQCHSIAPDNTQSNSGFTSWGP
SLFNVYNRTAGMSKGNSPFQVSPDMHTSGIIWNDLNLMKYMKNPKDFVEANIGMNFKGIS
NFQDRVDIVHYLRTLTYDDPHGKEIVEKFSKKGK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagctaggaataaaaagaacaacctgatagatgatgagctaccgaacgatttt
gtactacctgaaggggacaaagtgaaaggggagaaactgttcaagaagcactgtaagcaa
tgtcactccatagctccagacaacactcaatccaattcggggttcacaagttgggggccc
tctttatttaatgtttataacagaactgctggaatgagcaaaggaaattctccttttcag
gtatcacctgatatgcacacgtcaggtattatatggaacgatctaaatttaatgaagtac
atgaagaatcctaaagattttgtagaagcgaacattggtatgaattttaagggaatttca
aactttcaagatagggttgacatcgtgcactatttaagaacccttacgtatgatgatcca
catggaaaagaaattgtggagaaattttcgaaaaaaggaaaatag

DBGET integrated database retrieval system