KEGG   Plasmodium knowlesi: PKH_142130Help
Entry
PKH_142130        CDS       T01094                                 

Definition
(RefSeq) histone h2b
  KO
K11252  histone H2B
Organism
pkn  Plasmodium knowlesi
Brite
Chromosome [BR:pkn03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    PKH_142130
Exosome [BR:pkn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PKH_142130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone TFIID_20kDa CBFD_NFYB_HMF RP-C Asr YscO-like
Motif
Other DBs
NCBI-GeneID: 7323463
NCBI-ProteinID: XP_002262117
UniProt: A0A1A7VHT0 B3LC36
Position
14:complement(961452..961823)
Genome map
AA seq 123 aa AA seqDB search
MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQVHPETGVTKKSMNIMN
SFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaggaccagcgcaaaaatctcaagctgcaaagaaaactgcaggaaaaact
ttgggaccaaggcataagagaaaaagaagaacagagtcattttcactttacatttttaaa
gttttaaaacaagtgcatccagaaactggtgtgacaaaaaaaagcatgaatattatgaat
tctttcattaatgatatatttgacaggttagttaccgaagcaactagactaattcgttat
aacaagaagagaacattgtcatcacgtgaaattcaaactgccgttaggttacttttacct
ggagaattgtcaaaacacgccgtctctgaaggaaccaaagccgtaacaaagtacaccacc
agtggtgcatag

DBGET integrated database retrieval system