KEGG   Plasmodium knowlesi: PKH_142130Help
Entry
PKH_142130        CDS       T01094                                 

Definition
histone h2b
Orthology
K11252  
histone H2B
Organism
pkn  Plasmodium knowlesi
Brite
Exosome [BR:pkn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PKH_142130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14:complement(961452..961823)
Genome map
AA seq 123 aa AA seqDB search
MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQVHPETGVTKKSMNIMN
SFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaggaccagcgcaaaaatctcaagctgcaaagaaaactgcaggaaaaact
ttgggaccaaggcataagagaaaaagaagaacagagtcattttcactttacatttttaaa
gttttaaaacaagtgcatccagaaactggtgtgacaaaaaaaagcatgaatattatgaat
tctttcattaatgatatatttgacaggttagttaccgaagcaactagactaattcgttat
aacaagaagagaacattgtcatcacgtgaaattcaaactgccgttaggttacttttacct
ggagaattgtcaaaacacgccgtctctgaaggaaccaaagccgtaacaaagtacaccacc
agtggtgcatag

DBGET integrated database retrieval system