KEGG   Plasmodium knowlesi: PKH_142780Help
Entry
PKH_142780        CDS       T01094                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pkn  Plasmodium knowlesi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PKH_142780
Enzymes [BR:pkn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PKH_142780
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PKH_142780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14:complement(join(1245878..1245993,1246144..1248165,1248447..1248573))
Genome map
AA seq 754 aa AA seqDB search
MEDSNRWNSTPRNIAVLNFGTNDKQNCVTILETALYLTEKYLGKIINSSYIYETVPEYIV
LDEAKKIGKVREEQAPNKISWIKDLIENVEKSRYEESEDLIYECKELEMFLKNEKINESI
IKEVNVKDYENETRKIIKQNDEIMKTNLEKCKDKYYTSYFFNLAVVIRTFVEDPLTMLVI
LKYIEQIMKRRESKKCQGEIFENRIIDIDILFFNNYTIFEKSIELKKNDIHNIIKKYIHI
DHTSDQNRLEIIQNLSDKIEFLCIPHVYTKYRYSILLCLNDIIPEYKHNTFDETIRSTYK
NYINKFEYKYQINIRENNRKLYVLKDKVSYLKEKTHIVGILNVNYDSFSDGGLFVDPVKA
VDRIFEMTNDGATVIDIGGESSAPYVVPNPNVTERDLVIPVLKLFKEKWHAFEHEVVNNA
EGCAIMDDNKKNAQRDTEGATILQKVRDAKPTISIDTVNYDLFKECVEDDLVDILNDISA
CTHNPDIIKLLKRKNKFYTVVLMHKRGNPHTMDKLTNYDNLINDIKKYLEDRLNFLVLNG
IPRYRILFDVGLGFAKKHDQSIKLLQNIHVYDEYPLFLGYSRKRFIVHCMGKNSASNGGL
ELTKGKSDVPNGKSELANGKSELANGKSELANGKSELANGKSELANGKSELANGKSELAN
GKSELANGKSELANGKFELANGHSKLANGNASQLWNFKMNHMRQDKDQLLYQKNICGGLA
IASYSYYKKVDLIRVHDVLETKAVLDVLASIHES
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggaggattccaacaggtggaacagtaccccaaggaatatagccgttttaaacttcggc
accaatgacaaacagaattgcgtaacaattttagaaacagcgctatatctgacggagaag
tatcttgggaaaattatcaacagttcttacatttacgaaactgttccggaatacatcgtc
ctggatgaagcaaagaaaattggaaaggtaagagaggagcaggccccaaataaaatttct
tggataaaggatttgatcgagaatgtagaaaaatccagatacgaagaaagtgaagattta
atttatgagtgcaaagaactggaaatgtttttaaaaaatgaaaaaataaatgaaagcatt
atcaaggaagtgaatgtgaaggattacgaaaatgaaacaagaaaaataatcaaacagaat
gatgaaataatgaagacaaatttagaaaaatgtaaagataaatattacaccagttatttt
tttaacttagcagttgtaattcggacctttgttgaagacccccttaccatgctcgtaatt
ttaaagtacatagagcaaatcatgaaaagaagggaaagcaaaaagtgtcagggagaaata
tttgaaaatcgcataatagacattgacatattattttttaacaattacacaatttttgag
aaaagcatagaattaaaaaaaaatgacatacataatataatcaaaaaatatattcacata
gatcatactagtgatcagaaccgcctggaaattattcaaaatttaagcgacaaaatcgaa
ttcttatgtatccctcatgtgtacacaaaatataggtatagtatcctcctctgcttaaat
gatatcattcccgagtataagcacaacacatttgatgaaaccattcgctcaacctataaa
aattatattaacaaatttgaatataagtatcaaattaatataagggaaaataataggaag
ctatatgtcttgaaagataaagtatcatacttaaaggagaaaactcatatagtgggcatt
ttgaatgttaactacgattccttttctgatggtggcttgtttgttgatcctgtgaaagct
gtggacaggatattcgaaatgacgaatgatggggccaccgtgattgacatcggaggtgaa
tcatccgctccttatgtggtcccgaatcctaatgtcactgaacgcgatttggtcatcccc
gtgttgaagctatttaaagagaagtggcatgcttttgaacacgaggtcgtcaataatgcg
gagggctgcgctataatggacgataacaagaaaaacgcccagcgagatacagagggggct
accatcctacaaaaagtgagagacgcaaaaccgaccataagtattgacactgtgaattat
gatctgttcaaagaatgcgtggaagacgatttggtggatatcctaaacgatatcagtgcg
tgtacacacaacccagatattataaaattattaaaaaggaaaaataaattttatactgtc
gttttaatgcacaagaggggaaatccacacaccatggataagttaacaaattacgataac
cttataaatgacattaaaaagtatttagaagatcggttaaatttcctcgttctcaatggg
ataccacgttaccgaattctctttgatgttggattaggctttgccaaaaaacacgaccaa
tctattaagctcttgcagaatattcacgtttatgatgagtacccgctgtttcttggatac
tcgaggaagcgatttattgtccactgcatgggaaaaaatagcgctagcaatgggggccta
gaactgactaaagggaaatccgacgtgcccaacgggaagtctgaactggctaatgggaag
tctgaactggctaatgggaagtctgaactggctaatgggaagtctgaactggctaatggg
aagtctgaactggctaatgggaagtctgaactggctaatgggaaatctgaactggctaat
gggaaatctgaactggctaatgggaagtctgaactggctaatgggaagttcgaactggct
aatgggcactccaaactggcgaatggtaacgcatcacaactgtggaatttcaaaatgaac
catatgcgtcaggacaaggatcagcttttgtaccagaaaaatatttgcggcggattggcc
attgcttcctacagctattacaagaaggtggatcttatcagagttcacgacgtgttagaa
acgaaggcagttctggatgtgcttgcaagcatacatgaatcttag

DBGET integrated database retrieval system